PDB entry 6c43

View 6c43 on RCSB PDB site
Description: 2.9 Angstrom Resolution Crystal Structure of Gamma-Aminobutyraldehyde Dehydrogenase from Salmonella typhimurium.
Class: oxidoreductase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, Gamma-Aminobutyraldehyde Dehydrogenase, RIBOSOMAL PROTEIN, OXIDOREDUCTASE
Deposited on 2018-01-11, released 2018-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-aminobutyraldehyde dehydrogenase
    Species: Salmonella choleraesuis [TaxId:28901]
    Gene: prr, IN36_12155, IN69_10380, IN77_11880
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c43a_
  • Chain 'B':
    Compound: Gamma-aminobutyraldehyde dehydrogenase
    Species: Salmonella choleraesuis [TaxId:28901]
    Gene: prr, IN36_12155, IN69_10380, IN77_11880
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c43b_
  • Chain 'C':
    Compound: Gamma-aminobutyraldehyde dehydrogenase
    Species: Salmonella choleraesuis [TaxId:28901]
    Gene: prr, IN36_12155, IN69_10380, IN77_11880
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c43c_
  • Chain 'D':
    Compound: Gamma-aminobutyraldehyde dehydrogenase
    Species: Salmonella choleraesuis [TaxId:28901]
    Gene: prr, IN36_12155, IN69_10380, IN77_11880
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c43d_
  • Chain 'E':
    Compound: Gamma-aminobutyraldehyde dehydrogenase
    Species: Salmonella choleraesuis [TaxId:28901]
    Gene: prr, IN36_12155, IN69_10380, IN77_11880
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c43e_
  • Chain 'F':
    Compound: Gamma-aminobutyraldehyde dehydrogenase
    Species: Salmonella choleraesuis [TaxId:28901]
    Gene: prr, IN36_12155, IN69_10380, IN77_11880
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c43f_
  • Chain 'G':
    Compound: Gamma-aminobutyraldehyde dehydrogenase
    Species: Salmonella choleraesuis [TaxId:28901]
    Gene: prr, IN36_12155, IN69_10380, IN77_11880
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c43g_
  • Chain 'H':
    Compound: Gamma-aminobutyraldehyde dehydrogenase
    Species: Salmonella choleraesuis [TaxId:28901]
    Gene: prr, IN36_12155, IN69_10380, IN77_11880
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c43h_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c43A (A:)
    snamqyqllingvlvdgegerqsvynpatgevileiaeaspaqvdaavqaadnafaewgq
    ttpkaraecllkladsieqnalefarlesqncgkplhcvindeipaivdvfrffagaarc
    lsglaageyleghtsmirrdpigvvasiapwnyplmmaawklapalaagncvvikpseit
    pltalklavlakdifppgvlnvlfgrgqtvgdvltghekvrmvsltgsiatgehilrhta
    paikrthmelggkapvivfddadldavaqgvrtfgfynagqdctaacriyaqrgiydalv
    eklgnavsslkmgapedestelgplsslahlkrvtaaveeakalshirvitggsqtegkg
    yyfaptlladakqedaivqrevfgpvvsitvfddedqvlrwandsryglassvwtqdvgr
    ahrlsarlqygctwinthfmlvsemphggqkqsgygkdmslygledytlvrhimvkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c43A (A:)
    qyqllingvlvdgegerqsvynpatgevileiaeaspaqvdaavqaadnafaewgqttpk
    araecllkladsieqnalefarlesqncgkplhcvindeipaivdvfrffagaarclsgl
    aageyleghtsmirrdpigvvasiapwnyplmmaawklapalaagncvvikpseitplta
    lklavlakdifppgvlnvlfgrgqtvgdvltghekvrmvsltgsiatgehilrhtapaik
    rthmelggkapvivfddadldavaqgvrtfgfynagqdctaacriyaqrgiydalveklg
    navsslkmgapedestelgplsslahlkrvtaaveeakalshirvitggsqtegkgyyfa
    ptlladakqedaivqrevfgpvvsitvfddedqvlrwandsryglassvwtqdvgrahrl
    sarlqygctwinthfmlvsemphggqkqsgygkdmslygledytlvrhimvkh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6c43B (B:)
    snamqyqllingvlvdgegerqsvynpatgevileiaeaspaqvdaavqaadnafaewgq
    ttpkaraecllkladsieqnalefarlesqncgkplhcvindeipaivdvfrffagaarc
    lsglaageyleghtsmirrdpigvvasiapwnyplmmaawklapalaagncvvikpseit
    pltalklavlakdifppgvlnvlfgrgqtvgdvltghekvrmvsltgsiatgehilrhta
    paikrthmelggkapvivfddadldavaqgvrtfgfynagqdctaacriyaqrgiydalv
    eklgnavsslkmgapedestelgplsslahlkrvtaaveeakalshirvitggsqtegkg
    yyfaptlladakqedaivqrevfgpvvsitvfddedqvlrwandsryglassvwtqdvgr
    ahrlsarlqygctwinthfmlvsemphggqkqsgygkdmslygledytlvrhimvkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c43B (B:)
    qyqllingvlvdgegerqsvynpatgevileiaeaspaqvdaavqaadnafaewgqttpk
    araecllkladsieqnalefarlesqncgkplhcvindeipaivdvfrffagaarclsgl
    aageyleghtsmirrdpigvvasiapwnyplmmaawklapalaagncvvikpseitplta
    lklavlakdifppgvlnvlfgrgqtvgdvltghekvrmvsltgsiatgehilrhtapaik
    rthmelggkapvivfddadldavaqgvrtfgfynagqdctaacriyaqrgiydalveklg
    navsslkmgapedestelgplsslahlkrvtaaveeakalshirvitggsqtegkgyyfa
    ptlladakqedaivqrevfgpvvsitvfddedqvlrwandsryglassvwtqdvgrahrl
    sarlqygctwinthfmlvsemphggqkqsgygkdmslygledytlvrhimvkh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6c43C (C:)
    snamqyqllingvlvdgegerqsvynpatgevileiaeaspaqvdaavqaadnafaewgq
    ttpkaraecllkladsieqnalefarlesqncgkplhcvindeipaivdvfrffagaarc
    lsglaageyleghtsmirrdpigvvasiapwnyplmmaawklapalaagncvvikpseit
    pltalklavlakdifppgvlnvlfgrgqtvgdvltghekvrmvsltgsiatgehilrhta
    paikrthmelggkapvivfddadldavaqgvrtfgfynagqdctaacriyaqrgiydalv
    eklgnavsslkmgapedestelgplsslahlkrvtaaveeakalshirvitggsqtegkg
    yyfaptlladakqedaivqrevfgpvvsitvfddedqvlrwandsryglassvwtqdvgr
    ahrlsarlqygctwinthfmlvsemphggqkqsgygkdmslygledytlvrhimvkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c43C (C:)
    qyqllingvlvdgegerqsvynpatgevileiaeaspaqvdaavqaadnafaewgqttpk
    araecllkladsieqnalefarlesqncgkplhcvindeipaivdvfrffagaarclsgl
    aageyleghtsmirrdpigvvasiapwnyplmmaawklapalaagncvvikpseitplta
    lklavlakdifppgvlnvlfgrgqtvgdvltghekvrmvsltgsiatgehilrhtapaik
    rthmelggkapvivfddadldavaqgvrtfgfynagqdctaacriyaqrgiydalveklg
    navsslkmgapedestelgplsslahlkrvtaaveeakalshirvitggsqtegkgyyfa
    ptlladakqedaivqrevfgpvvsitvfddedqvlrwandsryglassvwtqdvgrahrl
    sarlqygctwinthfmlvsemphggqkqsgygkdmslygledytlvrhimvkh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6c43D (D:)
    snamqyqllingvlvdgegerqsvynpatgevileiaeaspaqvdaavqaadnafaewgq
    ttpkaraecllkladsieqnalefarlesqncgkplhcvindeipaivdvfrffagaarc
    lsglaageyleghtsmirrdpigvvasiapwnyplmmaawklapalaagncvvikpseit
    pltalklavlakdifppgvlnvlfgrgqtvgdvltghekvrmvsltgsiatgehilrhta
    paikrthmelggkapvivfddadldavaqgvrtfgfynagqdctaacriyaqrgiydalv
    eklgnavsslkmgapedestelgplsslahlkrvtaaveeakalshirvitggsqtegkg
    yyfaptlladakqedaivqrevfgpvvsitvfddedqvlrwandsryglassvwtqdvgr
    ahrlsarlqygctwinthfmlvsemphggqkqsgygkdmslygledytlvrhimvkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c43D (D:)
    qyqllingvlvdgegerqsvynpatgevileiaeaspaqvdaavqaadnafaewgqttpk
    araecllkladsieqnalefarlesqncgkplhcvindeipaivdvfrffagaarclsgl
    aageyleghtsmirrdpigvvasiapwnyplmmaawklapalaagncvvikpseitplta
    lklavlakdifppgvlnvlfgrgqtvgdvltghekvrmvsltgsiatgehilrhtapaik
    rthmelggkapvivfddadldavaqgvrtfgfynagqdctaacriyaqrgiydalveklg
    navsslkmgapedestelgplsslahlkrvtaaveeakalshirvitggsqtegkgyyfa
    ptlladakqedaivqrevfgpvvsitvfddedqvlrwandsryglassvwtqdvgrahrl
    sarlqygctwinthfmlvsemphggqkqsgygkdmslygledytlvrhimvkh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6c43E (E:)
    snamqyqllingvlvdgegerqsvynpatgevileiaeaspaqvdaavqaadnafaewgq
    ttpkaraecllkladsieqnalefarlesqncgkplhcvindeipaivdvfrffagaarc
    lsglaageyleghtsmirrdpigvvasiapwnyplmmaawklapalaagncvvikpseit
    pltalklavlakdifppgvlnvlfgrgqtvgdvltghekvrmvsltgsiatgehilrhta
    paikrthmelggkapvivfddadldavaqgvrtfgfynagqdctaacriyaqrgiydalv
    eklgnavsslkmgapedestelgplsslahlkrvtaaveeakalshirvitggsqtegkg
    yyfaptlladakqedaivqrevfgpvvsitvfddedqvlrwandsryglassvwtqdvgr
    ahrlsarlqygctwinthfmlvsemphggqkqsgygkdmslygledytlvrhimvkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c43E (E:)
    qyqllingvlvdgegerqsvynpatgevileiaeaspaqvdaavqaadnafaewgqttpk
    araecllkladsieqnalefarlesqncgkplhcvindeipaivdvfrffagaarclsgl
    aageyleghtsmirrdpigvvasiapwnyplmmaawklapalaagncvvikpseitplta
    lklavlakdifppgvlnvlfgrgqtvgdvltghekvrmvsltgsiatgehilrhtapaik
    rthmelggkapvivfddadldavaqgvrtfgfynagqdctaacriyaqrgiydalveklg
    navsslkmgapedestelgplsslahlkrvtaaveeakalshirvitggsqtegkgyyfa
    ptlladakqedaivqrevfgpvvsitvfddedqvlrwandsryglassvwtqdvgrahrl
    sarlqygctwinthfmlvsemphggqkqsgygkdmslygledytlvrhimvkh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6c43F (F:)
    snamqyqllingvlvdgegerqsvynpatgevileiaeaspaqvdaavqaadnafaewgq
    ttpkaraecllkladsieqnalefarlesqncgkplhcvindeipaivdvfrffagaarc
    lsglaageyleghtsmirrdpigvvasiapwnyplmmaawklapalaagncvvikpseit
    pltalklavlakdifppgvlnvlfgrgqtvgdvltghekvrmvsltgsiatgehilrhta
    paikrthmelggkapvivfddadldavaqgvrtfgfynagqdctaacriyaqrgiydalv
    eklgnavsslkmgapedestelgplsslahlkrvtaaveeakalshirvitggsqtegkg
    yyfaptlladakqedaivqrevfgpvvsitvfddedqvlrwandsryglassvwtqdvgr
    ahrlsarlqygctwinthfmlvsemphggqkqsgygkdmslygledytlvrhimvkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c43F (F:)
    qyqllingvlvdgegerqsvynpatgevileiaeaspaqvdaavqaadnafaewgqttpk
    araecllkladsieqnalefarlesqncgkplhcvindeipaivdvfrffagaarclsgl
    aageyleghtsmirrdpigvvasiapwnyplmmaawklapalaagncvvikpseitplta
    lklavlakdifppgvlnvlfgrgqtvgdvltghekvrmvsltgsiatgehilrhtapaik
    rthmelggkapvivfddadldavaqgvrtfgfynagqdctaacriyaqrgiydalveklg
    navsslkmgapedestelgplsslahlkrvtaaveeakalshirvitggsqtegkgyyfa
    ptlladakqedaivqrevfgpvvsitvfddedqvlrwandsryglassvwtqdvgrahrl
    sarlqygctwinthfmlvsemphggqkqsgygkdmslygledytlvrhimvkh
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6c43G (G:)
    snamqyqllingvlvdgegerqsvynpatgevileiaeaspaqvdaavqaadnafaewgq
    ttpkaraecllkladsieqnalefarlesqncgkplhcvindeipaivdvfrffagaarc
    lsglaageyleghtsmirrdpigvvasiapwnyplmmaawklapalaagncvvikpseit
    pltalklavlakdifppgvlnvlfgrgqtvgdvltghekvrmvsltgsiatgehilrhta
    paikrthmelggkapvivfddadldavaqgvrtfgfynagqdctaacriyaqrgiydalv
    eklgnavsslkmgapedestelgplsslahlkrvtaaveeakalshirvitggsqtegkg
    yyfaptlladakqedaivqrevfgpvvsitvfddedqvlrwandsryglassvwtqdvgr
    ahrlsarlqygctwinthfmlvsemphggqkqsgygkdmslygledytlvrhimvkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c43G (G:)
    qyqllingvlvdgegerqsvynpatgevileiaeaspaqvdaavqaadnafaewgqttpk
    araecllkladsieqnalefarlesqncgkplhcvindeipaivdvfrffagaarclsgl
    aageyleghtsmirrdpigvvasiapwnyplmmaawklapalaagncvvikpseitplta
    lklavlakdifppgvlnvlfgrgqtvgdvltghekvrmvsltgsiatgehilrhtapaik
    rthmelggkapvivfddadldavaqgvrtfgfynagqdctaacriyaqrgiydalveklg
    navsslkmgapedestelgplsslahlkrvtaaveeakalshirvitggsqtegkgyyfa
    ptlladakqedaivqrevfgpvvsitvfddedqvlrwandsryglassvwtqdvgrahrl
    sarlqygctwinthfmlvsemphggqkqsgygkdmslygledytlvrhimvkh
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6c43H (H:)
    snamqyqllingvlvdgegerqsvynpatgevileiaeaspaqvdaavqaadnafaewgq
    ttpkaraecllkladsieqnalefarlesqncgkplhcvindeipaivdvfrffagaarc
    lsglaageyleghtsmirrdpigvvasiapwnyplmmaawklapalaagncvvikpseit
    pltalklavlakdifppgvlnvlfgrgqtvgdvltghekvrmvsltgsiatgehilrhta
    paikrthmelggkapvivfddadldavaqgvrtfgfynagqdctaacriyaqrgiydalv
    eklgnavsslkmgapedestelgplsslahlkrvtaaveeakalshirvitggsqtegkg
    yyfaptlladakqedaivqrevfgpvvsitvfddedqvlrwandsryglassvwtqdvgr
    ahrlsarlqygctwinthfmlvsemphggqkqsgygkdmslygledytlvrhimvkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c43H (H:)
    qyqllingvlvdgegerqsvynpatgevileiaeaspaqvdaavqaadnafaewgqttpk
    araecllkladsieqnalefarlesqncgkplhcvindeipaivdvfrffagaarclsgl
    aageyleghtsmirrdpigvvasiapwnyplmmaawklapalaagncvvikpseitplta
    lklavlakdifppgvlnvlfgrgqtvgdvltghekvrmvsltgsiatgehilrhtapaik
    rthmelggkapvivfddadldavaqgvrtfgfynagqdctaacriyaqrgiydalveklg
    navsslkmgapedestelgplsslahlkrvtaaveeakalshirvitggsqtegkgyyfa
    ptlladakqedaivqrevfgpvvsitvfddedqvlrwandsryglassvwtqdvgrahrl
    sarlqygctwinthfmlvsemphggqkqsgygkdmslygledytlvrhimvkh