PDB entry 6c40

View 6c40 on RCSB PDB site
Description: CheY41PyTyrD54K from Thermotoga maritima
Class: signaling protein
Keywords: CheY, Chemotaxis, PyTyr, SIGNALING PROTEIN
Deposited on 2018-01-11, released 2018-10-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'B':
  Compound: Chemotaxis protein cheY
  Species: Thermotoga maritima MSB8 [TaxId:243274]
  Gene: cheY, TM_0700
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q56312 (0-117)
    • engineered mutation (39)
    • engineered mutation (52)
  Domains in SCOPe 2.08: d6c40b_
• Chain 'D':
  Compound: Chemotaxis protein cheY
  Species: Thermotoga maritima MSB8 [TaxId:243274]
  Gene: cheY, TM_0700
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q56312 (0-117)
    • engineered mutation (39)
    • engineered mutation (52)
  Domains in SCOPe 2.08: d6c40d_
• Heterogens: CU, HOH

PDB Chain Sequences:

• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6c40B (B:)
  gkrvlivddaafmrmmlkdiitkagyevageatngreavxkykelkpdivtmkitmpemn
  gidaikeimkidpnakiivcsamgqqamvieaikagakdfivkpfqpsrvvealnkvs
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6c40D (D:)
  gkrvlivddaafmrmmlkdiitkagyevageatngreavxkykelkpdivtmkitmpemn
  gidaikeimkidpnakiivcsamgqqamvieaikagakdfivkpfqpsrvvealnkvs