PDB entry 6c40

View 6c40 on RCSB PDB site
Description: CheY41PyTyrD54K from Thermotoga maritima
Class: signaling protein
Keywords: CheY, Chemotaxis, PyTyr, SIGNALING PROTEIN
Deposited on 2018-01-11, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Chemotaxis protein cheY
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: cheY, TM_0700
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56312 (0-117)
      • engineered mutation (39)
      • engineered mutation (52)
    Domains in SCOPe 2.07: d6c40b_
  • Chain 'D':
    Compound: Chemotaxis protein cheY
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: cheY, TM_0700
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56312 (0-117)
      • engineered mutation (39)
      • engineered mutation (52)
    Domains in SCOPe 2.07: d6c40d_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6c40B (B:)
    gkrvlivddaafmrmmlkdiitkagyevageatngreavxkykelkpdivtmkitmpemn
    gidaikeimkidpnakiivcsamgqqamvieaikagakdfivkpfqpsrvvealnkvs
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6c40D (D:)
    gkrvlivddaafmrmmlkdiitkagyevageatngreavxkykelkpdivtmkitmpemn
    gidaikeimkidpnakiivcsamgqqamvieaikagakdfivkpfqpsrvvealnkvs