PDB entry 6c1z

View 6c1z on RCSB PDB site
Description: Crystal structure of Apo Caenorhabditis elegans lipid binding protein 8 (LBP-8)
Class: lipid binding protein
Keywords: LBP8, LBP-8, FABP, fatty acid binding protein, lipid, lipid binding protein, lipid binding protein 8, C. elegans, Caenorhabditis elegans, aging, lysosome, lipid transport, monounsaturated fatty acids, fatty acid
Deposited on 2018-01-05, released 2019-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-09, with a file datestamp of 2019-01-04.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipid binding protein
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: lbp-8, CELE_T22G5.6, T22G5.6
    Database cross-references and differences (RAF-indexed):
    • Uniprot O02324 (1-137)
      • expression tag (0)
    Domains in SCOPe 2.07: d6c1za1, d6c1za2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6c1zA (A:)
    amvsmkefigrwklvhsenfeeylkeigvgllirkaasltsptleikldgdtwhfnqyst
    fknnklafkirekfveiapdersyntlvtfengkfishqdkikenhhssvfttwlengkl
    lqtyqsgsvicrrefvke