PDB entry 6c1k

View 6c1k on RCSB PDB site
Description: HypoPP mutant with ligand1
Class: metal transport
Keywords: Mutant, METAL TRANSPORT
Deposited on 2018-01-04, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ion transport protein
    Species: Arcobacter butzleri (strain RM4018) [TaxId:367737]
    Gene: Abu_1752
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8EVM5
      • engineered mutation (119)
      • engineered mutation (234)
    Domains in SCOPe 2.07: d6c1ka_
  • Chain 'B':
    Compound: Ion transport protein
    Species: Arcobacter butzleri (strain RM4018) [TaxId:367737]
    Gene: Abu_1752
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8EVM5 (18-End)
      • engineered mutation (119)
      • engineered mutation (234)
    Domains in SCOPe 2.07: d6c1kb_
  • Heterogens: GAI, PX4, NA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c1kA (A:)
    mdykddddkgslvprgshmylritnivessfftkfiiylivlngitmgletsktfmqsfg
    vyttlfnqivitiftieiilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlg
    vlrlfrlvtavpqmrkivsalisvipgmlsvialmtlffyifaimatqlfgerfpewfgt
    lgesfytlfqvmtleswsmgivrplmevypyawvffipfifvvtfvminlvvaicvdama
    ilnqkeeqhiidevqshedninneiiklreeivelkeliktslkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c1kA (A:)
    mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
    ilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlgvlrlfrlvtavpqmrkiv
    salisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtlesws
    mgivrplmevypyawvffipfifvvtfvminlvvaicvdam
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6c1kB (B:)
    mdykddddkgslvprgshmylritnivessfftkfiiylivlngitmgletsktfmqsfg
    vyttlfnqivitiftieiilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlg
    vlrlfrlvtavpqmrkivsalisvipgmlsvialmtlffyifaimatqlfgerfpewfgt
    lgesfytlfqvmtleswsmgivrplmevypyawvffipfifvvtfvminlvvaicvdama
    ilnqkeeqhiidevqshedninneiiklreeivelkeliktslkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c1kB (B:)
    mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
    ilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlgvlrlfrlvtavpqmrkiv
    salisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtlesws
    mgivrplmevypyawvffipfifvvtfvminlvvaicvdam