PDB entry 6c1c

View 6c1c on RCSB PDB site
Description: FGFR1 kinase complex with inhibitor SN37116
Class: transferase/transferase inhibitor
Keywords: Kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2018-01-04, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362 (Start-310)
      • engineered mutation (129)
    Domains in SCOPe 2.07: d6c1ca_
  • Chain 'B':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c1cb_
  • Heterogens: YY6, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c1cA (A:)
    gamsgvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavk
    mlksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylq
    arrppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvted
    nvmkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweif
    tlggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedl
    drivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c1cA (A:)
    lpedprwelprdrlvlgkplgegqvvlaeaigldkdkpnrvtkvavkmlksdatekdlsd
    lisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppsynpshnp
    eeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglpvkwmap
    ealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnctnel
    ymmmrdcwhavpsqrptfkqlvedldrivaltsnqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6c1cB (B:)
    gamsgvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavk
    mlksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylq
    arrppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvted
    nvmkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweif
    tlggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedl
    drivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c1cB (B:)
    yelpedprwelprdrlvlgkplgegfgqvvlaeaigldkpnrvtkvavkmlksdatekdl
    sdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrpqlsskdl
    vscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglalpvkwmapealfdri
    ythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnctnelymmmrdc
    whavpsqrptfkqlvedldrivaltsn