PDB entry 6c1b

View 6c1b on RCSB PDB site
Description: FGFR1 kinase complex with inhibitor SN37118
Class: Transferase/Transferase inhibitor
Keywords: kinase, Transferase-Transferase inhibitor complex
Deposited on 2018-01-04, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c1ba_
  • Chain 'B':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c1bb_
  • Heterogens: YY4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c1bA (A:)
    gamsgvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavk
    mlksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylq
    arrppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvted
    nvmkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweif
    tlggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedl
    drivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c1bA (A:)
    lpedprwelprdrlvlgkplgqvvlaeaigldkdkpnrvtkvavkmlksdatekdlsdli
    sememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrpeeqlsskdlvs
    cayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglpvkwmapealfdriythq
    sdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhav
    psqrptfkqlvedldrivaltsnqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6c1bB (B:)
    gamsgvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavk
    mlksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylq
    arrppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvted
    nvmkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweif
    tlggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedl
    drivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c1bB (B:)
    yelpedprwelprdrlvlgkplgegqvvlaeairvtkvavkmlksdatekdlsdliseme
    mmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrqlsskdlvscayqvar
    gmeylaskkcihrdlaarnvlvtednvmkiadfgllpvkwmapealfdriythqsdvwsf
    gvllweiftlggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrpt
    fkqlvedldrivalts