PDB entry 6c0m

View 6c0m on RCSB PDB site
Description: The synthesis, biological evaluation and structural insights of unsaturated 3-N-substituted sialic acids as probes of human parainfluenza virus-3 haemagglutinin-neuraminidase
Class: viral protein/inhibitor
Keywords: hemagglutinin-neuraminidase, inhibitor, sialic acid, human parainfluenza virus type 3, sialidase, VIRAL PROTEIN, viral protein-inhibitor complex
Deposited on 2018-01-01, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin-neuraminidase
    Species: Human respirovirus 3 [TaxId:11216]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c0ma_
  • Chain 'B':
    Compound: hemagglutinin-neuraminidase
    Species: Human respirovirus 3 [TaxId:11216]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c0mb_
  • Heterogens: CA, NAG, BMA, MAN, EDO, SO4, 8LM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6c0mA (A:)
    ithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcvrtpslvindl
    iyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslall
    ntdvyqlcstpkvdersdyassgiedivldivnhdgsisttrfknnnisfdqpyaalyps
    vgpgiyykgkiiflgygglehpinenaicnttgcpgktqrdcnqashspwfsdrrmvnsi
    ivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiiditd
    ysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqks
    rvnpvitystatervnelairnktlsagytttscithynkgycfhiveinhksldtfqpm
    lfkteipkscs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6c0mB (B:)
    ithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcvrtpslvindl
    iyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslall
    ntdvyqlcstpkvdersdyassgiedivldivnhdgsisttrfknnnisfdqpyaalyps
    vgpgiyykgkiiflgygglehpinenaicnttgcpgktqrdcnqashspwfsdrrmvnsi
    ivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiiditd
    ysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqks
    rvnpvitystatervnelairnktlsagytttscithynkgycfhiveinhksldtfqpm
    lfkteipkscs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c0mB (B:)
    ithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcvrtpslvindl
    iyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslall
    ntdvyqlcstpkvdersdyassgiedivldivnhdgsisttrfknnnisfdqpyaalyps
    vgpgiyykgkiiflgygglehpinenaicnttgcpgktqrdcnqashspwfsdrrmvnsi
    ivvdksipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiiditdysd
    irikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqksrvn
    pvitystatervnelairnktlsagytttscithynkgycfhiveinhksldtfqpmlfk
    teipkscs