PDB entry 6bzy

View 6bzy on RCSB PDB site
Description: Structure of the Hepatitis C virus envelope glycoprotein E2 antigenic region 412-423 bound to the 22D11 broadly neutralizing antibody
Class: immune system
Keywords: Hepatitis C virus, immune system, antibodies, broadly neutralizing antibodies, rational vaccine design, AS412, E2, VIRAL PROTEIN
Deposited on 2017-12-26, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: E2 AS412 peptide
    Species: Hepacivirus C [TaxId:11103]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BZY
  • Chain 'H':
    Compound: 22D11 Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BZY (0-219)
  • Chain 'L':
    Compound: 22D11 Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BZY (0-End)
    Domains in SCOPe 2.07: d6bzyl1, d6bzyl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6bzyL (L:)
    eivltqspaslavslgqratiscrasesvdnygisfmnwfqqkpgqppklliyaasnqgs
    gvparfsgsgsgtdfslnihpmeeddtamyfcqqskevpytfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bzyL (L:)
    eivltqspaslavslgqratiscrasesvdnygisfmnwfqqkpgqppklliyaasnqgs
    gvparfsgsgsgtdfslnihpmeeddtamyfcqqskevpytfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnr