PDB entry 6byf

View 6byf on RCSB PDB site
Description: Crystal structure of the core catalytic domain of PP-IP phosphatase SIW14 from S. cerevisiae in complex with citrate
Class: transferase
Keywords: protein tyrosine phosphatase, phosphatase, inositol, inositol polyphosphate, inositol pyrophosphate, substrate specificity, TRANSFERASE
Deposited on 2017-12-20, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: SIW14, YNL032W, N2746
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (4-169)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d6byfa1, d6byfa2
  • Chain 'B':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: SIW14, YNL032W, N2746
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (4-169)
      • expression tag (3)
    Domains in SCOPe 2.07: d6byfb1, d6byfb2
  • Chain 'C':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: SIW14, YNL032W, N2746
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (4-169)
      • expression tag (3)
    Domains in SCOPe 2.07: d6byfc1, d6byfc2
  • Chain 'D':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: SIW14, YNL032W, N2746
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (4-169)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d6byfd1, d6byfd2
  • Chain 'E':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: SIW14, YNL032W, N2746
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (4-169)
      • expression tag (3)
    Domains in SCOPe 2.07: d6byfe1, d6byfe2
  • Chain 'F':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: SIW14, YNL032W, N2746
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (4-169)
      • expression tag (3)
    Domains in SCOPe 2.07: d6byff1, d6byff2
  • Chain 'G':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: SIW14, YNL032W, N2746
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (4-169)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d6byfg1, d6byfg2
  • Chain 'H':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: SIW14, YNL032W, N2746
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (4-169)
      • expression tag (3)
    Domains in SCOPe 2.07: d6byfh1, d6byfh2
  • Chain 'I':
    Compound: Tyrosine-protein phosphatase SIW14
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: SIW14, YNL032W, N2746
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53965 (4-169)
      • expression tag (3)
    Domains in SCOPe 2.07: d6byfi1, d6byfi2
  • Heterogens: CIT, EDO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6byfA (A:)
    gsgsvippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflklt
    giklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihcnrgkhrtgcligcirkl
    qnwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6byfA (A:)
    sgsvippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltg
    iklyqvgmsgnvnipshlltkaleivlnpanqpilihcnrgkhrtgcligcirklqnwsl
    tmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6byfB (B:)
    gsgsvippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflklt
    giklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihcnrgkhrtgcligcirkl
    qnwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6byfB (B:)
    svippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltgik
    lyqvgmsgnfvnipshlltkaleivlnpanqpilihcnrgkhrtgcligcirklqnwslt
    mifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6byfC (C:)
    gsgsvippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflklt
    giklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihcnrgkhrtgcligcirkl
    qnwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6byfC (C:)
    svippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltgik
    lyqvgmsgnvnipshlltkaleivlnpanqpilihcnrgkhrtgcligcirklqnwsltm
    ifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6byfD (D:)
    gsgsvippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflklt
    giklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihcnrgkhrtgcligcirkl
    qnwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6byfD (D:)
    sgsvippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltg
    iklyqvgmsgnvnipshlltkaleivlnpanqpilihcnrgkhrtgcligcirklqnwsl
    tmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6byfE (E:)
    gsgsvippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflklt
    giklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihcnrgkhrtgcligcirkl
    qnwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6byfE (E:)
    svippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltgik
    lyqvgmsgnfvnipshlltkaleivlnpanqpilihcnrgkhrtgcligcirklqnwslt
    mifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6byfF (F:)
    gsgsvippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflklt
    giklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihcnrgkhrtgcligcirkl
    qnwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6byfF (F:)
    svippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltgik
    lyqvgmsgvnipshlltkaleivlnpanqpilihcnrgkhrtgcligcirklqnwsltmi
    fdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6byfG (G:)
    gsgsvippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflklt
    giklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihcnrgkhrtgcligcirkl
    qnwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6byfG (G:)
    sgsvippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltg
    iklyqvgmsgvnipshlltkaleivlnpanqpilihcnrgkhrtgcligcirklqnwslt
    mifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6byfH (H:)
    gsgsvippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflklt
    giklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihcnrgkhrtgcligcirkl
    qnwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6byfH (H:)
    svippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltgik
    lyqvgmsgnvnipshlltkaleivlnpanqpilihcnrgkhrtgcligcirklqnwsltm
    ifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6byfI (I:)
    gsgsvippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflklt
    giklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihcnrgkhrtgcligcirkl
    qnwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6byfI (I:)
    svippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltgik
    lyqvgmsgnvnipshlltkaleivlnpanqpilihcnrgkhrtgcligcirklqnwsltm
    ifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw