PDB entry 6by3

View 6by3 on RCSB PDB site
Description: Open and conductive conformation of KcsA-T75A mutant
Class: membrane protein
Keywords: KcsA, C-type inactivation, ion channel, potassium channel, MEMBRANE PROTEIN
Deposited on 2017-12-19, released 2018-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BY3 (0-218)
  • Chain 'B':
    Compound: Antibody Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BY3 (0-211)
    Domains in SCOPe 2.07: d6by3b1, d6by3b2
  • Chain 'C':
    Compound: pH-gated potassium channel KcsA
    Species: Streptomyces coelicolor [TaxId:100226]
    Gene: KCSA, SKC1, SCO7660, SC10F4.33
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A333 (0-90)
      • engineered mutation (2)
      • engineered mutation (49)
      • engineered mutation (64)
      • expression tag (91-95)
    Domains in SCOPe 2.07: d6by3c1, d6by3c2
  • Heterogens: F09, DGA, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6by3B (B:)
    dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
    rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6by3C (C:)
    wrcagaatvllvivllagsylavlaergapgaqlitypralwwsvetatavgygdlypvt
    lwgrcvavvvmvagitsfglvtaalatwfvgqcqqq