PDB entry 6by3
View 6by3 on RCSB PDB site
Description: Open and conductive conformation of KcsA-T75A mutant
Class: membrane protein
Keywords: KcsA, C-type inactivation, ion channel, potassium channel, MEMBRANE PROTEIN
Deposited on
2017-12-19, released
2018-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated
2018-05-09, with a file datestamp of
2018-05-04.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: N/A
AEROSPACI score: 0.22
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: antibody heavy chain
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Antibody Light Chain
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d6by3b1, d6by3b2 - Chain 'C':
Compound: pH-gated potassium channel KcsA
Species: Streptomyces coelicolor [TaxId:100226]
Gene: KCSA, SKC1, SCO7660, SC10F4.33
Database cross-references and differences (RAF-indexed):
- Uniprot P0A333 (0-90)
- engineered mutation (2)
- engineered mutation (49)
- engineered mutation (64)
- expression tag (91-95)
Domains in SCOPe 2.07: d6by3c1, d6by3c2 - Heterogens: F09, DGA, K, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>6by3B (B:)
dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleikradaaptvsifpp
sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
ltkdeyerhnsytceathktstspivksfnrn
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>6by3C (C:)
wrcagaatvllvivllagsylavlaergapgaqlitypralwwsvetatavgygdlypvt
lwgrcvavvvmvagitsfglvtaalatwfvgqcqqq