PDB entry 6by3

View 6by3 on RCSB PDB site
Description: Open and conductive conformation of KcsA-T75A mutant
Class: membrane protein
Keywords: KcsA, C-type inactivation, ion channel, potassium channel, MEMBRANE PROTEIN
Deposited on 2017-12-19, released 2018-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: antibody heavy chain
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 6BY3 (0-218)
• Chain 'B':
  Compound: Antibody Light Chain
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 6BY3 (0-211)
  Domains in SCOPe 2.07: d6by3b1, d6by3b2
• Chain 'C':
  Compound: pH-gated potassium channel KcsA
  Species: Streptomyces coelicolor [TaxId:100226]
  Gene: KCSA, SKC1, SCO7660, SC10F4.33
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A333 (0-90)
    • engineered mutation (2)
    • engineered mutation (49)
    • engineered mutation (64)
    • expression tag (91-95)
  Domains in SCOPe 2.07: d6by3c1, d6by3c2
• Heterogens: F09, DGA, K, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6by3B (B:)
  dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
  rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleikradaaptvsifpp
  sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
  ltkdeyerhnsytceathktstspivksfnrn
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6by3C (C:)
  wrcagaatvllvivllagsylavlaergapgaqlitypralwwsvetatavgygdlypvt
  lwgrcvavvvmvagitsfglvtaalatwfvgqcqqq