PDB entry 6bxh

View 6bxh on RCSB PDB site
Description: Menin in complex with MI-853
Class: Protein Binding, Transcription
Keywords: Protein binding, inhibitor, Transcription
Deposited on 2017-12-18, released 2018-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Menin
    Species: Homo sapiens [TaxId:9606]
    Gene: MEN1, SCG2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00255 (Start-451)
      • expression tag (452-453)
      • expression tag (464-503)
    Domains in SCOPe 2.07: d6bxha1, d6bxha2, d6bxha3
  • Heterogens: EE7, DMS, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bxhA (A:)
    ggsssmglkaaqktlfplrsiddvvrlfaaelgreepdlvllslvlgfvehflavnrvip
    tnvpeltfqpspapdppggltyfpvadlsiiaalyarftaqirgavdlslypreggvssr
    elvkkvsdviwnslsrsyfkdrahiqslfsfitgtkldssgvafavvgacqalglrdvhl
    alsedhawvvfgpngeqtaevtwhgkgnedrrgqtvnagvaerswlylkgsymrcdrkme
    vafmvcainpsidlhtdslellqlqqkllwllydlghlerypmalgnladleeleptpgr
    pdpltlyhkgiasaktyyrdehiypymylagyhcrnrnvrealqawadtatviqdynycr
    edeeiykeffevandvipnllkeaaslleagsqgsalqdpecfahllrfydgickweegs
    ptpvlhvgwatflvqslgrfegqvrqkvrivsvpapaaspppegpvltfqsekmkgmkel
    lvatkinssaiklqltaqsqvqmkkqkvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bxhA (A:)
    glkaaqktlfplrsiddvvrlfaaelgreepdlvllslvlgfvehflavnrvgltyfpva
    dlsiiaalyarftaqirgavdlslypreggvssrelvkkvsdviwnslsrsyfkdrahiq
    slfsfitgtkldssgvafavvgacqalglrdvhlalsedhawvvfgpngeqtaevtwhgk
    gnedrrgqtvnagvaerswlylkgsymrcdrkmevafmvcainpsidlhtdslellqlqq
    kllwllydlghlerypmalgnladleeleptpgrpdpltlyhkgiasaktyyrdehiypy
    mylagyhcrnrnvrealqawadtatviqdynycredeeiykeffevandvipnllkeaas
    lleagsqgsalqdpecfahllrfydgickweegsptpvlhvgwatflvqslgrfegqvrq
    kvrivsvppvltfqsekmkgmkellvatkinssaiklqltaqsqvqmk