PDB entry 6bx4

View 6bx4 on RCSB PDB site
Description: The crystal structure of fluoride channel Fluc Ec2 with Monobody S9
Class: transport protein
Keywords: Fluc, Fluoride channel, monobody, TRANSPORT PROTEIN
Deposited on 2017-12-16, released 2018-02-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fluoride ion transporter CrcB
  Species: Escherichia coli [TaxId:562]
  Gene: crcB, A4T40_27000, A8M81_25235, AC789_145pl00540, AKG99_27195, B7C53_24430, BET08_05210, BIU72_24510, BK292_28205, BK334_22235, BK373_23795, BMR46_27175, BMR58_00505, BMR59_25090, BMR61_25795, CDL37_21115, CNQ53_00195, ECONIH1_26550, ECS286_0026, MJ49_27125, pCTXM15_EC8_00123, pO103_22
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6J5N4 (0-122)
    • engineered mutation (23)
• Chain 'B':
  Compound: Fluoride ion transporter CrcB
  Species: Escherichia coli [TaxId:562]
  Gene: crcB, A4T40_27000, A8M81_25235, AC789_145pl00540, AKG99_27195, B7C53_24430, BET08_05210, BIU72_24510, BK292_28205, BK334_22235, BK373_23795, BMR46_27175, BMR58_00505, BMR59_25090, BMR61_25795, CDL37_21115, CNQ53_00195, ECONIH1_26550, ECS286_0026, MJ49_27125, pCTXM15_EC8_00123, pO103_22
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6J5N4 (0-122)
    • engineered mutation (23)
• Chain 'C':
  Compound: monobody
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 6BX4 (0-95)
  Domains in SCOPe 2.08: d6bx4c_
• Chain 'D':
  Compound: monobody
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 6BX4 (0-95)
  Domains in SCOPe 2.08: d6bx4d_
• Heterogens: F, DMU, NA, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6bx4C (C:)
  svssvptklevvaatptslliswdapavtvvhyvitygetggnspvqeftvpgskstati
  sglkpgvdytitvytmyysysdlysysspisinyrt
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6bx4D (D:)
  svssvptklevvaatptslliswdapavtvvhyvitygetggnspvqeftvpgskstati
  sglkpgvdytitvytmyysysdlysysspisinyrt