PDB entry 6bvv

View 6bvv on RCSB PDB site
Description: Nipah virus W protein C-terminus in complex with Importin alpha 3
Class: transport protein
Keywords: Complex, Nipah virus, Importin, Karyopherin, phosphoprotein, W, TRANSPORT PROTEIN
Deposited on 2017-12-13, released 2018-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Importin subunit alpha-3
    Species: Homo sapiens [TaxId:9606]
    Gene: KPNA4, QIP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bvva_
  • Chain 'B':
    Compound: Protein W
    Species: Nipah virus [TaxId:121791]
    Gene: P/V/C
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bvvA (A:)
    sgdyrvqntsleaivqnassdnqgiqlsavqaarkllssdrnppiddliksgilpilvhc
    lerddnpslqfeaawaltniasgtseqtqavvqsnavplflrllhsphqnvceqavwalg
    niigdgpqcrdyvislgvvkpllsfispsipitflrnvtwvmvnlcrhkdppppmetiqe
    ilpalcvlihhtdvnilvdtvwalsyltdagneqiqmvidsgivphlvpllshqevkvqt
    aalravgnivtgtdeqtqvvlncdalshfpallthpkekinkeavwflsnitagnqqqvq
    avidanlvpmiihlldkgdfgtqkeaawaisnltisgrkdqvayliqqnvippfcnlltv
    kdaqvvqvvldglsnilkmaedeaetignlieecgglekieqlqnhenediyklayeiid
    qffssddidedpslvpeaiqggtfgfnssanvptegfqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bvvA (A:)
    sleaivqnassdnqgiqlsavqaarkllssdrnppiddliksgilpilvhclerddnpsl
    qfeaawaltniasgtseqtqavvqsnavplflrllhsphqnvceqavwalgniigdgpqc
    rdyvislgvvkpllsfispsipitflrnvtwvmvnlcrhkdppppmetiqeilpalcvli
    hhtdvnilvdtvwalsyltdagneqiqmvidsgivphlvpllshqevkvqtaalravgni
    vtgtdeqtqvvlncdalshfpallthpkekinkeavwflsnitagnqqqvqavidanlvp
    miihlldkgdfgtqkeaawaisnltisgrkdqvayliqqnvippfcnlltvkdaqvvqvv
    ldglsnilkmaedeaetignlieecgglekieqlqnhenediyklayeiidqffss
    

  • Chain 'B':
    No sequence available.