PDB entry 6bvt

View 6bvt on RCSB PDB site
Description: Importin alpha 1 in cargo free state
Class: transport protein
Keywords: Importin, Karyopherin, Nuclear, Transport, TRANSPORT PROTEIN
Deposited on 2017-12-13, released 2018-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Importin subunit alpha-1
    Species: Mus musculus [TaxId:10090]
    Gene: Kpna2, Rch1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bvte_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6bvtE (E:)
    mhhhhhhssglvprgsgmletaaalfernhmdspdlgtddddlamadigsnqgtvnwsve
    divkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgktdcspiqfe
    sawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniagdgsafrdl
    vikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldaveqilptlvrl
    lhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivtpalraign
    ivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiqqvvnhglv
    pflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsakdtkiiqv
    ildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnliekyfsve
    eeedqnvvpettsegfafqvqdgapgtfnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bvtE (E:)
    gtvnwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgkt
    dcspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniag
    dgsafrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldaveq
    ilptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivt
    palraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiq
    qvvnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsa
    kdtkiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnl
    iekyfs