PDB entry 6bva

View 6bva on RCSB PDB site
Description: Ubiquitin Variant (UbV.Fl10.1) bound to a human Skp1-Fbl10 fragment complex.
Class: protein binding
Keywords: Ubiquitination, PROTEIN BINDING
Deposited on 2017-12-12, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 2.66 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG47 (2-85)
      • expression tag (0-1)
      • engineered mutation (10-13)
      • insertion (13)
      • insertion (13)
      • insertion (13)
      • insertion (13)
      • insertion (13)
      • engineered mutation (51)
      • engineered mutation (55-56)
      • engineered mutation (58)
      • engineered mutation (77)
      • engineered mutation (81-85)
    Domains in SCOPe 2.07: d6bvaa1, d6bvaa2
  • Chain 'B':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG47 (2-End)
      • engineered mutation (10-13)
      • insertion (13)
      • insertion (13)
      • insertion (13)
      • insertion (13)
      • insertion (13)
      • engineered mutation (51)
      • engineered mutation (55-56)
      • engineered mutation (58)
      • engineered mutation (77)
      • engineered mutation (81-82)
    Domains in SCOPe 2.07: d6bvab_
  • Chain 'C':
    Compound: S-phase kinase-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SKP1, EMC19, OCP2, SKP1A, TCEB1L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bvac1, d6bvac2
  • Chain 'D':
    Compound: S-phase kinase-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SKP1, EMC19, OCP2, SKP1A, TCEB1L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63208 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d6bvad1, d6bvad2, d6bvad3
  • Chain 'E':
    Compound: Lysine-specific demethylase 2B
    Species: Homo sapiens [TaxId:9606]
    Gene: KDM2B, CXXC2, FBL10, FBXL10, JHDM1B, PCCX2
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Lysine-specific demethylase 2B
    Species: Homo sapiens [TaxId:9606]
    Gene: KDM2B, CXXC2, FBL10, FBXL10, JHDM1B, PCCX2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6bvaA (A:)
    gsgmqifvktfrdrlrnllpqtitlevepsdtienvkakiqdkegippdqqvlifsrkrl
    edgrtlsdyniqkestlrlvlvfgrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bvaB (B:)
    gsgmqifvktfrdrlrnllpqtitlevepsdtienvkakiqdkegippdqqvlifsrkrl
    edgrtlsdyniqkestlrlvlvfgrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bvaB (B:)
    gmqifvktfrdrlrnllpqtitlevepsdtienvkakiqdkegippdqqvlifsrkrled
    grtlsdyniqkestlrlvlvf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6bvaC (C:)
    gampsiklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkkv
    iqwcthhkddppppeddenkekrtddipvwdqeflkvdqgtlfelilaanyldikglldv
    tcktvanmikgktpeeirktfnikndfteeeeaqvrkenqwceek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bvaC (C:)
    mpsiklqssdgeifevdveiakqsvtiktmledldddpvplpnvnaailkkviqwcthhk
    ddppppeddekrtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikg
    ktpeeirktfnikndfteeeeaqvrkenqwce
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6bvaD (D:)
    gampsiklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkkv
    iqwcthhkddppppeddenkekrtddipvwdqeflkvdqgtlfelilaanyldikglldv
    tcktvanmikgktpeeirktfnikndfteeeeaqvrkenqwceek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bvaD (D:)
    ampsiklqssdgeifevdveiakqsvtiktmledlddpvplpnvnaailkkviqwcthhk
    ddppppeddekrtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikg
    ktpeeirktfnikndeeeeaqvrkenqwce
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.