PDB entry 6bul

View 6bul on RCSB PDB site
Description: Crystal structure of Staphylococcus aureus ketol-acid reductoisomerase with hydroxyoxamate inhibitor 2
Class: Oxidoreductase/Inhibitor
Keywords: ketol-acid reductoisomerase, inhibitor, Oxidoreductase-Inhibitor complex
Deposited on 2017-12-10, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ketol-acid reductoisomerase (NADP(+))
    Species: Staphylococcus aureus (strain bovine RF122 / ET3-1) [TaxId:273036]
    Gene: ilvC, SAB1941
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bula1, d6bula2
  • Chain 'B':
    Compound: Ketol-acid reductoisomerase (NADP(+))
    Species: Staphylococcus aureus (strain bovine RF122 / ET3-1) [TaxId:273036]
    Gene: ilvC, SAB1941
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bulb1, d6bulb2
  • Heterogens: MG, NAP, E9G, E9J, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bulA (A:)
    mttvyydqdvktdalqgkkiavvgygsqghahaqnlkdngydvvigirpgrsfdkakedg
    fdvfpvaeavkqadvimvllpdeiqgdvykneiepnlekhnalafahgfnihfgviqppa
    dvdvflvapkgpghlvrrtfvegsavpslfgiqqdasgqarnialsyakgigatragvie
    ttfkeetetdlfgeqavlcggvskliqsgfetlveagyqpelayfevlhemklivdlmye
    ggmenvrysisntaefgdyvsgprvitpdvkenmkavltdiqngnfsnrfiednkngfke
    fyklreeqhghqiekvgrelremmpfiksksiekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bulA (A:)
    ttvyydqdvktdalqgkkiavvgygsqghahaqnlkdngydvvigirpgrsfdkakedgf
    dvfpvaeavkqadvimvllpdeiqgdvykneiepnlekhnalafahgfnihfgviqppad
    vdvflvapkgpghlvrrtfvegsavpslfgiqqdasgqarnialsyakgigatragviet
    tfkeetetdlfgeqavlcggvskliqsgfetlveagyqpelayfevlhemklivdlmyeg
    gmenvrysisntaefgdyvsgprvitpdvkenmkavltdiqngnfsnrfiednkngfkef
    yklreeqhghqiekvgrelre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bulB (B:)
    mttvyydqdvktdalqgkkiavvgygsqghahaqnlkdngydvvigirpgrsfdkakedg
    fdvfpvaeavkqadvimvllpdeiqgdvykneiepnlekhnalafahgfnihfgviqppa
    dvdvflvapkgpghlvrrtfvegsavpslfgiqqdasgqarnialsyakgigatragvie
    ttfkeetetdlfgeqavlcggvskliqsgfetlveagyqpelayfevlhemklivdlmye
    ggmenvrysisntaefgdyvsgprvitpdvkenmkavltdiqngnfsnrfiednkngfke
    fyklreeqhghqiekvgrelremmpfiksksiekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bulB (B:)
    ttvyydqdvktdalqgkkiavvgygsqghahaqnlkdngydvvigirpgrsfdkakedgf
    dvfpvaeavkqadvimvllpdeiqgdvykneiepnlekhnalafahgfnihfgviqppad
    vdvflvapkgpghlvrrtfvegsavpslfgiqqdasgqarnialsyakgigatragviet
    tfkeetetdlfgeqavlcggvskliqsgfetlveagyqpelayfevlhemklivdlmyeg
    gmenvrysisntaefgdyvsgprvitpdvkenmkavltdiqngnfsnrfiednkngfkef
    yklreeqhghqiekvgrelremmpfik