PDB entry 6bu3

View 6bu3 on RCSB PDB site
Description: CTX-M-27 Beta-Lactamase in Complex with a Non-Covalent Tetrazole Inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: tetrazole, inhibitor, beta-lactamase, ESBL, HYDROLASE, hydrolase-hydrolase inhibitor complex
Deposited on 2017-12-08, released 2018-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B5LY47 (0-261)
      • conflict (72)
    Domains in SCOPe 2.07: d6bu3a_
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B5LY47 (0-261)
      • conflict (72)
    Domains in SCOPe 2.07: d6bu3b_
  • Heterogens: 3GK, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6bu3A (A:)
    tsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqset
    qkqllnqpveikhadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpg
    gvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraq
    lvtwlkgnttgaasiraglptswtvgdktgsggygttndiaviwpqgraplvlvtyftqp
    qqnaesrrdvlasaariiaegl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6bu3B (B:)
    tsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqset
    qkqllnqpveikhadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpg
    gvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraq
    lvtwlkgnttgaasiraglptswtvgdktgsggygttndiaviwpqgraplvlvtyftqp
    qqnaesrrdvlasaariiaegl