PDB entry 6bu2

View 6bu2 on RCSB PDB site
Description: Crystal structure of methylmalonyl-CoA epimerase from Mycobacterium tuberculosis
Class: isomerase
Keywords: Epimerase Metal Binding Methylmalonate Pathway VOC superfamily, ISOMERASE
Deposited on 2017-12-08, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glyoxalase
    Species: Mycobacterium tuberculosis H37Rv [TaxId:83332]
    Gene: LH57_07245
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A089QP00 (0-144)
      • expression tag (145-149)
    Domains in SCOPe 2.07: d6bu2a1, d6bu2a2
  • Chain 'B':
    Compound: glyoxalase
    Species: Mycobacterium tuberculosis H37Rv [TaxId:83332]
    Gene: LH57_07245
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A089QP00 (0-144)
      • expression tag (145-150)
    Domains in SCOPe 2.07: d6bu2b1, d6bu2b2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bu2A (A:)
    harhmlatslvtgldhvgiavadldvaiewyhdhlgmilvheeinddqgireallavpgs
    aaqiqlmapldessviakfldkrgpgiqqlacrvsdldamcrrlrsqgvrlvyetarrgt
    ansrinfihpkdaggvlielvepapklaaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bu2A (A:)
    harhmlatslvtgldhvgiavadldvaiewyhdhlgmilvheeinddqgireallavpgs
    aaqiqlmapldessviakfldkrgpgiqqlacrvsdldamcrrlrsqgvrlvyetarrgt
    ansrinfihpkdaggvlielvepapklaaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6bu2B (B:)
    harhmlatslvtgldhvgiavadldvaiewyhdhlgmilvheeinddqgireallavpgs
    aaqiqlmapldessviakfldkrgpgiqqlacrvsdldamcrrlrsqgvrlvyetarrgt
    ansrinfihpkdaggvlielvepapklaaal