PDB entry 6btj

View 6btj on RCSB PDB site
Description: Crystal structure of pan-H7, anti-hemagglutinin monoclonal antibody H7.5 (Fab fragment)
Class: antiviral protein
Keywords: anti-HA neutralizing antibody, H7 specific, ANTIVIRAL PROTEIN
Deposited on 2017-12-06, released 2018-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heavy chain of H7.5 Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BTJ
  • Chain 'B':
    Compound: Light chain of H7.5 Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BTJ (0-End)
    Domains in SCOPe 2.07: d6btjb1, d6btjb2
  • Chain 'H':
    Compound: Heavy chain of H7.5 Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BTJ
  • Chain 'L':
    Compound: Light chain of H7.5 Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BTJ (0-End)
    Domains in SCOPe 2.07: d6btjl1, d6btjl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6btjB (B:)
    eivmtqspsslsasvgdrvtitcrpsqsistflnwyeqkpgkapklliydasslqsgvps
    rfsgsgsgteftltisslqpedfatyycqqsfstpytfgqgtrleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6btjB (B:)
    eivmtqspsslsasvgdrvtitcrpsqsistflnwyeqkpgkapklliydasslqsgvps
    rfsgsgsgteftltisslqpedfatyycqqsfstpytfgqgtrleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6btjL (L:)
    eivmtqspsslsasvgdrvtitcrpsqsistflnwyeqkpgkapklliydasslqsgvps
    rfsgsgsgteftltisslqpedfatyycqqsfstpytfgqgtrleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6btjL (L:)
    eivmtqspsslsasvgdrvtitcrpsqsistflnwyeqkpgkapklliydasslqsgvps
    rfsgsgsgteftltisslqpedfatyycqqsfstpytfgqgtrleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge