PDB entry 6bti

View 6bti on RCSB PDB site
Description: Crystal structure of human cellular retinol binding protein 2 (CRBP2) in complex with N-arachidonoylethanolamine (AEA)
Class: lipid binding protein
Keywords: endocannabinoid, N-arachidonoylethanolamine, anandamide, retinol, vitamin A, LIPID BINDING PROTEIN
Deposited on 2017-12-06, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinol-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: RBP2, CRBP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50120 (0-133)
      • expression tag (134-135)
    Domains in SCOPe 2.07: d6btia1, d6btia2
  • Chain 'B':
    Compound: Retinol-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: RBP2, CRBP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50120 (0-133)
      • expression tag (134-136)
    Domains in SCOPe 2.07: d6btib1, d6btib2
  • Heterogens: E7Y, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6btiA (A:)
    mtrdqngtwemesnenfegymkaldidfatrkiavrltqtkvidqdgdnfktkttstfrn
    ydvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkqwiegdklylel
    tcgdqvcrqvfkkklvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6btiA (A:)
    mtrdqngtwemesnenfegymkaldidfatrkiavrltqtkvidqdgdnfktkttstfrn
    ydvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkqwiegdklylel
    tcgdqvcrqvfkkklv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6btiB (B:)
    mtrdqngtwemesnenfegymkaldidfatrkiavrltqtkvidqdgdnfktkttstfrn
    ydvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkqwiegdklylel
    tcgdqvcrqvfkkklvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6btiB (B:)
    mtrdqngtwemesnenfegymkaldidfatrkiavrltqtkvidqdgdnfktkttstfrn
    ydvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkqwiegdklylel
    tcgdqvcrqvfkkklvp