PDB entry 6bsm

View 6bsm on RCSB PDB site
Description: BMP1 complexed with a reverse hydroxamate - compound 4
Class: hydrolase/hydrolase inhibitor
Keywords: endopeptidase, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2017-12-04, released 2018-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bone morphogenetic protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BMP1, PCOLC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bsma_
  • Heterogens: ZN, E7D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6bsmA (A:)
    aatsrpervwpdgvipfviggnftgsqravfrqamrhwekhtcvtflertdedsyivfty
    rpcgccsyvgrrgggpqaisigkncdkfgivvhelghvvgfwhehtrpdrdrhvsivren
    iqpgqeynflkmepqeveslgetydfdsimhyarntfsrgifldtivpkyevngvkppig
    qrtrlskgdiaqarklykcp