PDB entry 6brq

View 6brq on RCSB PDB site
Description: Crystal structure of rice ASK1-D3 ubiquitin ligase complex crystal form 3
Class: ligase
Keywords: Ubiquitin ligase, F-box, LIGASE
Deposited on 2017-11-30, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SKP1-like protein 1A
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: SKP1A, ASK1, SKP1, UIP1, At1g75950, T4O12.17
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6brqa1
  • Chain 'B':
    Compound: F-box/LRR-repeat MAX2 homolog
    Species: Oryza sativa subsp. japonica [TaxId:39947]
    Gene: D3, Os06g0154200, LOC_Os06g06050, OSJNBa0085L11.6-1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: SKP1-like protein 1A
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: SKP1A, ASK1, SKP1, UIP1, At1g75950, T4O12.17
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6brqc1
  • Chain 'D':
    Compound: F-box/LRR-repeat MAX2 homolog
    Species: Oryza sativa subsp. japonica [TaxId:39947]
    Gene: D3, Os06g0154200, LOC_Os06g06050, OSJNBa0085L11.6-1
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6brqA (A:)
    msakkivlkssdgesfeveeavalesqtiahmveddcvdngvplpnvtskilakvieyck
    rhveaaaskaeavegaatsdddlkawdadfmkidqatlfelilaanylniknlldltcqt
    vadmikgktpeeirttfnikndftpeeeeevrrenqwafe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6brqA (A:)
    vevalesqtiahmvlpnvtskilakvieyckrdadfmkidqatlfelilaanylniknll
    dltcqtvadmikgktpeeirttfnikndftpeeeeevrrenqwafe
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6brqC (C:)
    msakkivlkssdgesfeveeavalesqtiahmveddcvdngvplpnvtskilakvieyck
    rhveaaaskaeavegaatsdddlkawdadfmkidqatlfelilaanylniknlldltcqt
    vadmikgktpeeirttfnikndftpeeeeevrrenqwafe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6brqC (C:)
    alesqtiahvtskilakvieyckrwdadfmkidqatlfelilaanylniknlldltcqtv
    admikgktpeeirttfnikndftpeeeeevrrenqwafe
    

  • Chain 'D':
    No sequence available.