PDB entry 6brb

View 6brb on RCSB PDB site
Description: Novel non-antibody protein scaffold targeting CD40L
Class: structural protein/immune system
Keywords: Tn3 related, TNF ligand related, STRUCTURAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2017-11-30, released 2018-12-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.82 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cd40 ligand
    Species: Homo sapiens [TaxId:9606]
    Gene: CD40LG, CD40L, TNFSF5, TRAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6brba_
  • Chain 'D':
    Compound: Tn3-like
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BRB (0-86)
    Domains in SCOPe 2.08: d6brbd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6brbA (A:)
pqiaahviseasskttsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqvtfcs
nreassqapfiaslclkspgrferillraanthssakpcgqqsihlggvfelqpgasvfv
nvtdpsqvshgtgftsfgllkl

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6brbD (D:)
aievkdvtdttalitwsddfgeyvwceltygikdvpgdrttidlwyhhahysignlkpdt
eyevslicrrgdmssnpaketfttglv