PDB entry 6br7

View 6br7 on RCSB PDB site
Description: Beryllium fluorinated receiver domain of BfmR from Acinetobacter baumannii
Class: transcription
Keywords: response regulator, transcription regulator, TRANSCRIPTION
Deposited on 2017-11-30, released 2018-02-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Two-component system response regulator protein
    Species: Acinetobacter sp. 25977_8 [TaxId:1310912]
    Gene: J811_1009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6br7a_
  • Chain 'B':
    Compound: Two-component system response regulator protein
    Species: Acinetobacter sp. 25977_8 [TaxId:1310912]
    Gene: J811_1009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6br7b_
  • Heterogens: BEF, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6br7A (A:)
    gshmsqeeklpkilivedderlarltqeylirnglevgvetdgnrairriiseqpdlvvl
    dvmlpgadgltvcrevrphyhqpilmltartedmdqvlglemgaddyvakpvqprvllar
    irallrrtdktve
    

    Sequence, based on observed residues (ATOM records): (download)
    >6br7A (A:)
    eklpkilivedderlarltqeylirnglevgvetdgnrairriiseqpdlvvldvmlpga
    dgltvcrevrphyhqpilmltartedmdqvlglemgaddyvakpvqprvllarirallrr
    t
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6br7B (B:)
    gshmsqeeklpkilivedderlarltqeylirnglevgvetdgnrairriiseqpdlvvl
    dvmlpgadgltvcrevrphyhqpilmltartedmdqvlglemgaddyvakpvqprvllar
    irallrrtdktve
    

    Sequence, based on observed residues (ATOM records): (download)
    >6br7B (B:)
    eeklpkilivedderlarltqeylirnglevgvetdgnrairriiseqpdlvvldvmlpg
    adgltvcrevrphyhqpilmltartedmdqvlglemgaddyvakpvqprvllarirallr
    rtdkt