PDB entry 6bpp

View 6bpp on RCSB PDB site
Description: E. coli MsbA in complex with LPS and inhibitor G092
Class: lipid transport
Keywords: ABC transporter, inhibitor, LPS, MsbA, LIPID TRANSPORT
Deposited on 2017-11-24, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 2.92 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipid A export ATP-binding/permease protein msbA
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: msbA, Z1260, ECs0997
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bppa1, d6bppa2
  • Chain 'B':
    Compound: Lipid A export ATP-binding/permease protein msbA
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: msbA, Z1260, ECs0997
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bppb1, d6bppb2
  • Heterogens: E1M, FTT, DAO, 3PE, PA1, GCS, KDO, GMH, GLC, PO4, MYR

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bppA (A:)
    shndkdlstwqtfrrlwptiapfkaglivagvalilnaasdtfmlsllkpllddgfgktd
    rsvlvwmplvviglmilrgitsyvssyciswvsgkvvmtmrrrlfghmmgmpvsffdkqs
    tgtllsritydseqvassssgalitvvregasiiglfimmfyyswqlsiilivlapivsi
    airvvskrfrnisknmqntmgqvttsaeqmlkghkevlifggqevetkrfdkvsnrmrlq
    gmkmvsassisdpiiqliaslalafvlyaasfpsvmdsltagtitvvfssmialmrplks
    ltnvnaqfqrgmaacqtlftildseqekdegkrvieratgdvefrnvtftypgrdvpalr
    ninlkipagktvalvgrsgsgkstiaslitrfydidegeilmdghdlreytlaslrnqva
    lvsqnvhlfndtvanniayarteqysreqieeaarmayamdfinkmdngldtvigengvl
    lsggqrqriaiarallrdspilildeatsaldteseraiqaaldelqknrtslviahrls
    tiekadeivvvedgvivergthndllehrgvyaqlhkmqfgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bppA (A:)
    dkdlstwqtfrrlwptiapfkaglivagvalilnaasdtfmlsllkpllddgfgktdrsv
    lvwmplvviglmilrgitsyvssyciswvsgkvvmtmrrrlfghmmgmpvsffdkqstgt
    llsritydseqvassssgalitvvregasiiglfimmfyyswqlsiilivlapivsiair
    vvskrfrnisknmqntmgqvttsaeqmlkghkevlifggqevetkrfdkvsnrmrlqgmk
    mvsassisdpiiqliaslalafvlyaasfpsvmdsltagtitvvfssmialmrplksltn
    vnaqfqrgmaacqtlftildseqekdegkrvieratgdvefrnvtftypgrdvpalrnin
    lkipagktvalvgrsgsgkstiaslitrfydidegeilmdghdlreytlaslrnqvalvs
    qnvhlfndtvanniayarteqysreqieeaarmayamdfinkmdngldtvigengvllsg
    gqrqriaiarallrdspilildeatsaldteseraiqaaldelqknrtslviahrlstie
    kadeivvvedgvivergthndllehrgvyaqlhkmq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bppB (B:)
    shndkdlstwqtfrrlwptiapfkaglivagvalilnaasdtfmlsllkpllddgfgktd
    rsvlvwmplvviglmilrgitsyvssyciswvsgkvvmtmrrrlfghmmgmpvsffdkqs
    tgtllsritydseqvassssgalitvvregasiiglfimmfyyswqlsiilivlapivsi
    airvvskrfrnisknmqntmgqvttsaeqmlkghkevlifggqevetkrfdkvsnrmrlq
    gmkmvsassisdpiiqliaslalafvlyaasfpsvmdsltagtitvvfssmialmrplks
    ltnvnaqfqrgmaacqtlftildseqekdegkrvieratgdvefrnvtftypgrdvpalr
    ninlkipagktvalvgrsgsgkstiaslitrfydidegeilmdghdlreytlaslrnqva
    lvsqnvhlfndtvanniayarteqysreqieeaarmayamdfinkmdngldtvigengvl
    lsggqrqriaiarallrdspilildeatsaldteseraiqaaldelqknrtslviahrls
    tiekadeivvvedgvivergthndllehrgvyaqlhkmqfgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bppB (B:)
    stwqtfrrlwptiapfkaglivagvalilnaasdtfmlsllkpllddgfgktdrsvlvwm
    plvviglmilrgitsyvssyciswvsgkvvmtmrrrlfghmmgmpvsffdkqstgtllsr
    itydseqvassssgalitvvregasiiglfimmfyyswqlsiilivlapivsiairvvsn
    tmgqvttsaeqmlkghkevlifggqevetkrfdkvsnrmrlqgmkmvsassisdpiiqli
    aslalafvlyaasfpsvmdsltagtitvvfssmialmrplksltnvnaqfqrgmaacqtl
    ftildseqekdegkrvieratgdvefrnvtftypgrdvpalrninlkipagktvalvgrs
    gsgkstiaslitrfydidegeilmdghdlreytlaslrnqvalvsqnvhlfndtvannia
    yarteqysreqieeaarmayamdfinkmdngldtvigengvllsggqrqriaiarallrd
    spilildeatsaldteseraiqaaldelqknrtslviahrlstiekadeivvvedgvive
    rgthndllehrgvyaqlhkmq