PDB entry 6bpl

View 6bpl on RCSB PDB site
Description: E. coli MsbA in complex with LPS and inhibitor G907
Class: lipid transport
Keywords: ABC transporter, inhibitor, LPS, MsbA, LIPID TRANSPORT
Deposited on 2017-11-23, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipid A export ATP-binding/permease protein msbA
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: msbA, Z1260, ECs0997
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bpla1, d6bpla2
  • Chain 'B':
    Compound: Lipid A export ATP-binding/permease protein msbA
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: msbA, Z1260, ECs0997
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bplb1, d6bplb2
  • Heterogens: 3PE, AU7, FTT, GMH, GLC, PA1, PO4, GCS, KDO, DAO, MYR, DPO

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bplA (A:)
    shndkdlstwqtfrrlwptiapfkaglivagvalilnaasdtfmlsllkpllddgfgktd
    rsvlvwmplvviglmilrgitsyvssyciswvsgkvvmtmrrrlfghmmgmpvsffdkqs
    tgtllsritydseqvassssgalitvvregasiiglfimmfyyswqlsiilivlapivsi
    airvvskrfrnisknmqntmgqvttsaeqmlkghkevlifggqevetkrfdkvsnrmrlq
    gmkmvsassisdpiiqliaslalafvlyaasfpsvmdsltagtitvvfssmialmrplks
    ltnvnaqfqrgmaacqtlftildseqekdegkrvieratgdvefrnvtftypgrdvpalr
    ninlkipagktvalvgrsgsgkstiaslitrfydidegeilmdghdlreytlaslrnqva
    lvsqnvhlfndtvanniayarteqysreqieeaarmayamdfinkmdngldtvigengvl
    lsggqrqriaiarallrdspilildeatsaldteseraiqaaldelqknrtslviahrls
    tiekadeivvvedgvivergthndllehrgvyaqlhkmqfgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bplA (A:)
    dkdlstwqtfrrlwptiapfkaglivagvalilnaasdtfmlsllkpllddgfgktdrsv
    lvwmplvviglmilrgitsyvssyciswvsgkvvmtmrrrlfghmmgmpvsffdkqstgt
    llsritydseqvassssgalitvvregasiiglfimmfyyswqlsiilivlapivsiair
    vvskrfrnisknmqntmgqvttsaeqmlkghkevlifggqevetkrfdkvsnrmrlqgmk
    mvsassisdpiiqliaslalafvlyaasfpsvmdsltagtitvvfssmialmrplksltn
    vnaqfqrgmaacqtlftildseqekdegkrvieratgdvefrnvtftypgrdvpalrnin
    lkipagktvalvgrsgsgkstiaslitrfydidegeilmdghdlreytlaslrnqvalvs
    qnvhlfndtvanniayarteqysreqieeaarmayamdfinkmdngldtvigengvllsg
    gqrqriaiarallrdspilildeatsaldteseraiqaaldelqknrtslviahrlstie
    kadeivvvedgvivergthndllehrgvyaqlhkmq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bplB (B:)
    shndkdlstwqtfrrlwptiapfkaglivagvalilnaasdtfmlsllkpllddgfgktd
    rsvlvwmplvviglmilrgitsyvssyciswvsgkvvmtmrrrlfghmmgmpvsffdkqs
    tgtllsritydseqvassssgalitvvregasiiglfimmfyyswqlsiilivlapivsi
    airvvskrfrnisknmqntmgqvttsaeqmlkghkevlifggqevetkrfdkvsnrmrlq
    gmkmvsassisdpiiqliaslalafvlyaasfpsvmdsltagtitvvfssmialmrplks
    ltnvnaqfqrgmaacqtlftildseqekdegkrvieratgdvefrnvtftypgrdvpalr
    ninlkipagktvalvgrsgsgkstiaslitrfydidegeilmdghdlreytlaslrnqva
    lvsqnvhlfndtvanniayarteqysreqieeaarmayamdfinkmdngldtvigengvl
    lsggqrqriaiarallrdspilildeatsaldteseraiqaaldelqknrtslviahrls
    tiekadeivvvedgvivergthndllehrgvyaqlhkmqfgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bplB (B:)
    lstwqtfrrlwptiapfkaglivagvalilnaasdtfmlsllkpllddgfgktdrsvlvw
    mplvviglmilrgitsyvssyciswvsgkvvmtmrrrlfghmmgmpvsffdkqstgtlls
    ritydseqvassssgalitvvregasiiglfimmfyyswqlsiilivlapivsiairvvs
    krfntmgqvttsaeqmlkghkevlifggqevetkrfdkvsnrmrlqgmkmvsassisdpi
    iqliaslalafvlyaasfpsvmdsltagtitvvfssmialmrplksltnvnaqfqrgmaa
    cqtlftildseqekdegkrvieratgdvefrnvtftypgrdvpalrninlkipagktval
    vgrsgsgkstiaslitrfydidegeilmdghdlreytlaslrnqvalvsqnvhlfndtva
    nniayarteqysreqieeaarmayamdfinkmdngldtvigengvllsggqrqriaiara
    llrdspilildeatsaldteseraiqaaldelqknrtslviahrlstiekadeivvvedg
    vivergthndllehrgvyaqlhkmq