PDB entry 6bpg

View 6bpg on RCSB PDB site
Description: Crystal structure of betaine aldehyde dehydrogenase from Pseudomonas aeruginosa with bound rubidium ions
Class: oxidoreductase
Keywords: cation binding site, aldehyde dehydrogenase, badh, oxidoreductase
Deposited on 2017-11-23, released 2018-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 3.09 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD/NADP-dependent betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: betB, PA5373
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bpga_
  • Chain 'B':
    Compound: NAD/NADP-dependent betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: betB, PA5373
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bpgb_
  • Chain 'C':
    Compound: NAD/NADP-dependent betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: betB, PA5373
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bpgc_
  • Chain 'D':
    Compound: NAD/NADP-dependent betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: betB, PA5373
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bpgd_
  • Chain 'E':
    Compound: NAD/NADP-dependent betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: betB, PA5373
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bpge_
  • Chain 'F':
    Compound: NAD/NADP-dependent betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: betB, PA5373
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bpgf_
  • Chain 'G':
    Compound: NAD/NADP-dependent betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: betB, PA5373
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bpgg_
  • Chain 'H':
    Compound: NAD/NADP-dependent betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: betB, PA5373
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bpgh_
  • Heterogens: RB

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bpgA (A:)
    marfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvw
    aamtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglv
    paiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsev
    tpltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmas
    asssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqa
    rfeakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtd
    gafgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvv
    tqdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvq
    velgdyasvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bpgA (A:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
    sssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqar
    feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
    afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
    qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
    elgdyasvf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bpgB (B:)
    marfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvw
    aamtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglv
    paiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsev
    tpltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmas
    asssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqa
    rfeakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtd
    gafgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvv
    tqdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvq
    velgdyasvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bpgB (B:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
    sssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqar
    feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
    afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
    qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
    elgdyasvf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6bpgC (C:)
    marfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvw
    aamtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglv
    paiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsev
    tpltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmas
    asssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqa
    rfeakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtd
    gafgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvv
    tqdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvq
    velgdyasvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bpgC (C:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
    sssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqar
    feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
    afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
    qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
    elgdyasvf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6bpgD (D:)
    marfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvw
    aamtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglv
    paiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsev
    tpltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmas
    asssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqa
    rfeakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtd
    gafgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvv
    tqdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvq
    velgdyasvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bpgD (D:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
    sssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqar
    feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
    afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
    qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
    elgdyasvf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6bpgE (E:)
    marfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvw
    aamtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglv
    paiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsev
    tpltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmas
    asssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqa
    rfeakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtd
    gafgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvv
    tqdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvq
    velgdyasvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bpgE (E:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
    sssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqar
    feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
    afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
    qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
    elgdyasvf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6bpgF (F:)
    marfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvw
    aamtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglv
    paiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsev
    tpltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmas
    asssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqa
    rfeakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtd
    gafgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvv
    tqdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvq
    velgdyasvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bpgF (F:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
    sssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqar
    feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
    afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
    qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
    elgdyasvf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6bpgG (G:)
    marfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvw
    aamtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglv
    paiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsev
    tpltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmas
    asssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqa
    rfeakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtd
    gafgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvv
    tqdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvq
    velgdyasvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bpgG (G:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
    sssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqar
    feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
    afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
    qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
    elgdyasvf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6bpgH (H:)
    marfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvw
    aamtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglv
    paiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsev
    tpltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmas
    asssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqa
    rfeakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtd
    gafgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvv
    tqdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvq
    velgdyasvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bpgH (H:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
    sssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqar
    feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
    afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
    qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
    elgdyasvf