PDB entry 6bpf

View 6bpf on RCSB PDB site
Description: CTX-M-151 class A extended-spectrum beta-lactamase crystal structure in complex with avibactam at 1.32 Angstrom resolution.
Class: hydrolase/hydrolase inhibitor
Keywords: Beta-lactamase; DBO; diazabicyclooctane; penicilloil-serine-transferase; antibiotic resistance, HYDROLASE, hydrolase-hydrolase inhibitor complex
Deposited on 2017-11-23, released 2018-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Salmonella enterica [TaxId:28901]
    Gene: blaCTX-M151
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bpfa_
  • Heterogens: NXL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6bpfA (A:)
    nhiqhqmvqqlsaleksangrlgvavidtgsgaiagwrmdepfpmcstskvmavaallkq
    seqtpelmsqpqpvasgdlvnynpiterfvgksmtfdelsaatlqysdnaamnlilaklg
    gpqkvtafarsigddkfrldrnepslntaipgdlrdtstpramalslqklalgdalgqvq
    reklshwlrgnttgaasiraglpsgwsvgdktgsgdygttndiavvwptgrpplvivtyf
    tqpqqqaesqrpvlakaaaivashy