PDB entry 6bop

View 6bop on RCSB PDB site
Description: Crystal structure of 2-methylcitrate synthase from Aspergillus fumigatus
Class: transferase
Keywords: mcsA, 2-methylcitrate synthase, citrate synthase, TRANSFERASE
Deposited on 2017-11-20, released 2018-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-methylcitrate synthase, mitochondrial
    Species: Neosartorya fumigata [TaxId:746128]
    Gene: mcsA, cit1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q50I20
      • engineered mutation (327)
    Domains in SCOPe 2.07: d6bopa_
  • Chain 'B':
    Compound: 2-methylcitrate synthase, mitochondrial
    Species: Neosartorya fumigata [TaxId:746128]
    Gene: mcsA, cit1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q50I20
      • engineered mutation (327)
    Domains in SCOPe 2.07: d6bopb_
  • Chain 'C':
    Compound: 2-methylcitrate synthase, mitochondrial
    Species: Neosartorya fumigata [TaxId:746128]
    Gene: mcsA, cit1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q50I20
      • engineered mutation (327)
    Domains in SCOPe 2.07: d6bopc_
  • Chain 'D':
    Compound: 2-methylcitrate synthase, mitochondrial
    Species: Neosartorya fumigata [TaxId:746128]
    Gene: mcsA, cit1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q50I20 (4-End)
      • engineered mutation (327)
    Domains in SCOPe 2.07: d6bopd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bopA (A:)
    sgsgstaepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegs
    vldpeegirfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelae
    qshlpqhildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsi
    sllakiprvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlyla
    lhgdheggnvsahathlvgsalsdpflsysagllglagplhglaaqevlrwilamqdkig
    tkftdddvrnylwdtlksgrvvpgyghavlrkpdprfqalmdfaatrpdvlanpvfqlvk
    knseiapavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliw
    dralglpierpksinllglkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bopA (A:)
    aepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegsvldpee
    girfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelaeqshlpq
    hildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsisllaki
    prvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlylalhgdhe
    ggnvsahathlvgsalsdpflsysagllglagplhglaaqevlrwilamqdkigtkftdd
    dvrnylwdtlksgrvvpgyghavlrkpdprfqalmdfaatrpdvlanpvfqlvkknseia
    pavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliwdralgl
    pierpksinllglk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bopB (B:)
    sgsgstaepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegs
    vldpeegirfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelae
    qshlpqhildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsi
    sllakiprvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlyla
    lhgdheggnvsahathlvgsalsdpflsysagllglagplhglaaqevlrwilamqdkig
    tkftdddvrnylwdtlksgrvvpgyghavlrkpdprfqalmdfaatrpdvlanpvfqlvk
    knseiapavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliw
    dralglpierpksinllglkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bopB (B:)
    aepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegsvldpee
    girfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelaeqshlpq
    hildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsisllaki
    prvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlylalhgdhe
    ggnvsahathlvgsalsdpflsysagllglagplhglaaqevlrwilamqdkigtkftdd
    dvrnylwdtlksgrvvpgyghavlrkpdprfqalmdfaatrpdvlanpvfqlvkknseia
    pavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliwdralgl
    pierpksinllglk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6bopC (C:)
    sgsgstaepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegs
    vldpeegirfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelae
    qshlpqhildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsi
    sllakiprvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlyla
    lhgdheggnvsahathlvgsalsdpflsysagllglagplhglaaqevlrwilamqdkig
    tkftdddvrnylwdtlksgrvvpgyghavlrkpdprfqalmdfaatrpdvlanpvfqlvk
    knseiapavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliw
    dralglpierpksinllglkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bopC (C:)
    aepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegsvldpee
    girfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelaeqshlpq
    hildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsisllaki
    prvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlylalhgdhe
    ggnvsahathlvgsalsdpflsysagllglagplhglaaqevlrwilamqdkigtkftdd
    dvrnylwdtlksgrvvpgyghavlrkpdprfqalmdfaatrpdvlanpvfqlvkknseia
    pavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliwdralgl
    pierpksinllglk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6bopD (D:)
    sgsgstaepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegs
    vldpeegirfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelae
    qshlpqhildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsi
    sllakiprvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlyla
    lhgdheggnvsahathlvgsalsdpflsysagllglagplhglaaqevlrwilamqdkig
    tkftdddvrnylwdtlksgrvvpgyghavlrkpdprfqalmdfaatrpdvlanpvfqlvk
    knseiapavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliw
    dralglpierpksinllglkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bopD (D:)
    staepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegsvldp
    eegirfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelaeqshl
    pqhildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsislla
    kiprvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlylalhgd
    heggnvsahathlvgsalsdpflsysagllglagplhglaaqevlrwilamqdkigtkdd
    dvrnylwdtlksgrvvpgyghavlrkpdprfqalmdfaatrpdvlanpvfqlvkknseia
    pavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliwdralgl
    pierpksinllglk