PDB entry 6bom

View 6bom on RCSB PDB site
Description: Crystal structure of mutant 2-methylcitrate synthase mcsAG306A from Aspergillus fumigatus.
Class: transferase
Keywords: mcsA, 2-methylcitrate synthase, citrate synthase, TRANSFERASE
Deposited on 2017-11-20, released 2018-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-methylcitrate synthase, mitochondrial
    Species: Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) [TaxId:451804]
    Gene: mcsA, AFUB_094700
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0YD89 (4-440)
      • expression tag (1-3)
      • engineered mutation (281)
    Domains in SCOPe 2.07: d6boma1, d6boma2
  • Chain 'B':
    Compound: 2-methylcitrate synthase, mitochondrial
    Species: Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) [TaxId:451804]
    Gene: mcsA, AFUB_094700
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0YD89
      • engineered mutation (281)
    Domains in SCOPe 2.07: d6bomb_
  • Chain 'C':
    Compound: 2-methylcitrate synthase, mitochondrial
    Species: Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) [TaxId:451804]
    Gene: mcsA, AFUB_094700
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0YD89
      • engineered mutation (281)
    Domains in SCOPe 2.07: d6bomc_
  • Chain 'D':
    Compound: 2-methylcitrate synthase, mitochondrial
    Species: Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) [TaxId:451804]
    Gene: mcsA, AFUB_094700
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0YD89 (Start-440)
      • engineered mutation (281)
    Domains in SCOPe 2.07: d6bomd_
  • Chain 'E':
    Compound: 2-methylcitrate synthase, mitochondrial
    Species: Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) [TaxId:451804]
    Gene: mcsA, AFUB_094700
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0YD89
      • engineered mutation (281)
    Domains in SCOPe 2.07: d6bome_
  • Chain 'F':
    Compound: 2-methylcitrate synthase, mitochondrial
    Species: Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) [TaxId:451804]
    Gene: mcsA, AFUB_094700
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0YD89
      • engineered mutation (281)
    Domains in SCOPe 2.07: d6bomf_
  • Heterogens: TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bomA (A:)
    sgsgstaepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegs
    vldpeegirfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelae
    qshlpqhildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsi
    sllakiprvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlyla
    lhgdheggnvsahathlvgsalsdpflsysagllglagplhalaaqevlrwilamqdkig
    tkftdddvrnylwdtlksgrvvpgyghgvlrkpdprfqalmdfaatrpdvlanpvfqlvk
    knseiapavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliw
    dralglpierpksinllglkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bomA (A:)
    gsgstaepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegsv
    ldpeegirfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelaeq
    shlpqhildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsis
    llakiprvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlylal
    hgdheggnvsahathlvgsalsdpflsysagllglagplhalaaqevlrwilamqdkigt
    kftdddvrnylwdtlksgrvvpgyghgvlrkpdprfqalmdfaatrpdvlanpvfqlvkk
    nseiapavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliwd
    ralglpierpksinllglkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bomB (B:)
    sgsgstaepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegs
    vldpeegirfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelae
    qshlpqhildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsi
    sllakiprvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlyla
    lhgdheggnvsahathlvgsalsdpflsysagllglagplhalaaqevlrwilamqdkig
    tkftdddvrnylwdtlksgrvvpgyghgvlrkpdprfqalmdfaatrpdvlanpvfqlvk
    knseiapavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliw
    dralglpierpksinllglkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bomB (B:)
    taepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegsvldpe
    egirfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelaeqshlp
    qhildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsisllak
    iprvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlylalhgdh
    eggnvsahathlvgsalsdpflsysagllglagplhalaaqevlrwilamqdkigtkftd
    ddvrnylwdtlksgrvvpgyghgvlrkpdprfqalmdfaatrpdvlanpvfqlvkknsei
    apavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliwdralg
    lpierpksinllglk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6bomC (C:)
    sgsgstaepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegs
    vldpeegirfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelae
    qshlpqhildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsi
    sllakiprvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlyla
    lhgdheggnvsahathlvgsalsdpflsysagllglagplhalaaqevlrwilamqdkig
    tkftdddvrnylwdtlksgrvvpgyghgvlrkpdprfqalmdfaatrpdvlanpvfqlvk
    knseiapavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliw
    dralglpierpksinllglkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bomC (C:)
    taepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegsvldpe
    egirfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelaeqshlp
    qhildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsisllak
    iprvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlylalhgdh
    eggnvsahathlvgsalsdpflsysagllglagplhalaaqevlrwilamqdkigtkftd
    ddvrnylwdtlksgrvvpgyghgvlrkpdprfqalmdfaatrpdvlanpvfqlvkknsei
    apavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliwdralg
    lpierpksinllglk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6bomD (D:)
    sgsgstaepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegs
    vldpeegirfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelae
    qshlpqhildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsi
    sllakiprvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlyla
    lhgdheggnvsahathlvgsalsdpflsysagllglagplhalaaqevlrwilamqdkig
    tkftdddvrnylwdtlksgrvvpgyghgvlrkpdprfqalmdfaatrpdvlanpvfqlvk
    knseiapavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliw
    dralglpierpksinllglkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bomD (D:)
    taepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegsvldpe
    egirfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelaeqshlp
    qhildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsisllak
    iprvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlylalhgdh
    eggnvsahathlvgsalsdpflsysagllglagplhalaaqevlrwilamqdkigtkftd
    ddvrnylwdtlksgrvvpgyghgvlrkpdprfqalmdfaatrpdvlanpvfqlvkknsei
    apavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliwdralg
    lpierpksinllglkk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6bomE (E:)
    sgsgstaepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegs
    vldpeegirfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelae
    qshlpqhildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsi
    sllakiprvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlyla
    lhgdheggnvsahathlvgsalsdpflsysagllglagplhalaaqevlrwilamqdkig
    tkftdddvrnylwdtlksgrvvpgyghgvlrkpdprfqalmdfaatrpdvlanpvfqlvk
    knseiapavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliw
    dralglpierpksinllglkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bomE (E:)
    aepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegsvldpee
    girfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelaeqshlpq
    hildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsisllaki
    prvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlylalhgdhe
    ggnvsahathlvgsalsdpflsysagllglagplhalaaqevlrwilamqdkigtkftdd
    dvrnylwdtlksgrvvpgyghgvlrkpdprfqalmdfaatrpdvlanpvfqlvkknseia
    pavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliwdralgl
    pierpksinllglk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6bomF (F:)
    sgsgstaepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegs
    vldpeegirfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelae
    qshlpqhildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsi
    sllakiprvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlyla
    lhgdheggnvsahathlvgsalsdpflsysagllglagplhalaaqevlrwilamqdkig
    tkftdddvrnylwdtlksgrvvpgyghgvlrkpdprfqalmdfaatrpdvlanpvfqlvk
    knseiapavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliw
    dralglpierpksinllglkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bomF (F:)
    aepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegsvldpee
    girfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelaeqshlpq
    hildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsisllaki
    prvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlylalhgdhe
    ggnvsahathlvgsalsdpflsysagllglagplhalaaqevlrwilamqdkigtkftdd
    dvrnylwdtlksgrvvpgyghgvlrkpdprfqalmdfaatrpdvlanpvfqlvkknseia
    pavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliwdralgl
    pierpksinllglk