PDB entry 6bnn

View 6bnn on RCSB PDB site
Description: Crystal structure of V278E-glyoxalase I mutant from Zea mays in space group P4(1)2(1)2
Class: plant protein
Keywords: plant protein
Deposited on 2017-11-17, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactoylglutathione lyase
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6TPH0 (Start-295)
      • engineered mutation (283)
    Domains in SCOPe 2.07: d6bnna1, d6bnna2
  • Heterogens: GSH, CO, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bnnA (A:)
    gshmasmatgseaskaaeavvdwhkhdskrmlhavyrvgdldrtikyytecfgmkllrkr
    dvpdekytnaflgfgpentnfaveltynygvdkydigtgfghfaianddvyklaeniksk
    ggkitrepgpvkggstviafaqdpdgymfeliqradtpeplcqvmlrvgdlersikfyek
    algmkllrkkdvpdykytiamlgyadedkttvleltynygvteyskgnayaqvaigtndv
    yksaeavdlatkelggkilrqpgplpgintkiasfvdpdgwkvelvdntdflkelh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bnnA (A:)
    kaaeavvdwhkhdskrmlhavyrvgdldrtikyytecfgmkllrkrdvpdekytnaflgf
    gpentnfaveltynygvdkydigtgfghfaianddvyklaenikskggkitrepgpvkgg
    stviafaqdpdgymfeliqradtpeplcqvmlrvgdlersikfyekalgmkllrkkdvpd
    ykytiamlgyadedkttvleltynygvteyskgnayaqvaigtndvyksaeavdlatkel
    ggkilrqpgplpgintkiasfvdpdgwkvelvdntdflkelh