PDB entry 6bnm

View 6bnm on RCSB PDB site
Description: Crystal Structure of the P-Rex2 PH domain
Class: lipid binding protein
Keywords: pleckstrin homology domain, beta sandwich, phosphatidylinositol-binding, LIPID BINDING PROTEIN
Deposited on 2017-11-17, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PREX2, DEPDC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70Z35 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d6bnma1, d6bnma2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bnmA (A:)
    gefeklevleewqshiegwegsnitdtctemlmcgvllkissgniqervfflfdnllvyc
    krkhrrlknskastdghrylfrgrintevmevenvddgtadfhssghivvngwkihntak
    nkwfvcmaktpeekhewfeailkererrkglklgmeqdtwvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bnmA (A:)
    gefeklevleewqshiegwegsnitdtctemlmcgvllkissgniqervfflfdnllvyc
    krkhrylfrgrintevmevenvddgtadfhssghivvngwkihntaknkwfvcmaktpee
    khewfeailkererrkg