PDB entry 6bn6

View 6bn6 on RCSB PDB site
Description: identification of bicyclic hexafluoroisopropyl alcohol sulfonamides as rorgt/rorc inverse agonists
Class: transcription/transcription inhibitor
Keywords: RORGT, NUCLEAR HORMONE RECEPTOR, LIGAND-BINDING DOMAIN, INVERSE AGONIST, TRANSCRIPTION-TRANSCRIPTION INHIBITOR complex
Deposited on 2017-11-16, released 2017-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bn6a_
  • Chain 'B':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449 (21-End)
      • expression tag (20)
    Domains in SCOPe 2.07: d6bn6b1, d6bn6b2
  • Heterogens: XGH, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bn6A (A:)
    mgsshhhhhhssglvprgshmaslteiehlvqsvcksyretcqlrledllrqrsnifsre
    evtgyqrksmwemwercahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlv
    rmcraynadnrtvffegkyggmelfralgcselissifdfshslsalhfsedeialytal
    vlinahrpglqekrkveqlqynlelafhhhlckthrqsilaklppkgklrslcsqhverl
    qifqhlhpivvqaafpplykelfst
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bn6A (A:)
    aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
    teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
    melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
    nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bn6B (B:)
    mgsshhhhhhssglvprgshmaslteiehlvqsvcksyretcqlrledllrqrsnifsre
    evtgyqrksmwemwercahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlv
    rmcraynadnrtvffegkyggmelfralgcselissifdfshslsalhfsedeialytal
    vlinahrpglqekrkveqlqynlelafhhhlckthrqsilaklppkgklrslcsqhverl
    qifqhlhpivvqaafpplykelfst
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bn6B (B:)
    maslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahh
    lteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyg
    gmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlq
    ynlelafhhhlckthrqsilaklppkgklrslcsqhverlqif