PDB entry 6bn3

View 6bn3 on RCSB PDB site
Description: CTX-M-151 class A extended-spectrum beta-lactamase apo crystal structure at 1.3 Angstrom resolution.
Class: hydrolase
Keywords: Beta-lactamase; penicilloil-serine-transferase; antibiotic resistance, HYDROLASE
Deposited on 2017-11-16, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Salmonella enterica [TaxId:28901]
    Gene: blaCTX-M151
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bn3a_
  • Heterogens: EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6bn3A (A:)
    anhiqhqmvqqlsaleksangrlgvavidtgsgaiagwrmdepfpmcstskvmavaallk
    qseqtpelmsqpqpvasgdlvnynpiterfvgksmtfdelsaatlqysdnaamnlilakl
    ggpqkvtafarsigddkfrldrnepslntaipgdlrdtstpramalslqklalgdalgqv
    qreklshwlrgnttgaasiraglpsgwsvgdktgsgdygttndiavvwptgrpplvivty
    ftqpqqqaesqrpvlakaaaivashyv