PDB entry 6blr

View 6blr on RCSB PDB site
Description: Crystal Structure of IAg7 in complex with insulin mimotope p8E9E6SS
Class: immune system
Keywords: insulin, type I diabetes, t cell, autoimmune disease, immune system
Deposited on 2017-11-11, released 2017-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: IAg7 alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04228 (0-End)
      • enginered mutation (63)
    Domains in SCOPe 2.07: d6blra1, d6blra2
  • Chain 'B':
    Compound: H2-Ab1 protein
    Species: Mus musculus [TaxId:10090]
    Gene: H2-Ab1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q31135
      • see remark 999 (1-12)
      • linker (13-21)
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6blrA (A:)
    dieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqg
    glqciaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppvin
    itwlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwgleepvlkhw
    epe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6blrA (A:)
    dieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqg
    glqciaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppvin
    itwlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwgleepvlkhw
    ep
    

  • Chain 'B':
    No sequence available.