PDB entry 6blb

View 6blb on RCSB PDB site
Description: 1.88 Angstrom Resolution Crystal Structure Holliday Junction ATP-dependent DNA Helicase (RuvB) from Pseudomonas aeruginosa in Complex with ADP
Class: hydrolase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, Holliday Junction ATP-dependent DNA Helicase, ADP, HYDROLASE
Deposited on 2017-11-09, released 2017-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Holliday junction ATP-dependent DNA helicase ruvB
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: ruvB, PA0967
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6blba1, d6blba2
  • Heterogens: ADP, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6blbA (A:)
    snamiepdrlisavsgrerdeqldrairplkladyigqpsvreqmelfihaargrqeald
    htlifgppglgkttlaniiaqemgvsikstsgpvlerpgdlaalltnleagdvlfvdeih
    rlspiveevlypamedfqldimigegpaarsikldlppftlvgattragmltnplrdrfg
    ivqrlefynvedlativsrsagilgleiepqgaaeiakrargtprianrllrrvrdfaev
    rgqgditrviadkalnlldvdergfdhldrrllltmidkfdggpvgidnlaaalseerht
    iedvlepyliqqgyimrtprgrvvtrhaylhfglnipkrlgpgvttdlftsedgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6blbA (A:)
    airplkladyigqpsvreqmelfihaargrqealdhtlifgppglgkttlaniiaqemgv
    sikstsgpvlerpgdlaalltnleagdvlfvdeihrlspiveevlypamedfqldimiar
    sikldlppftlvgattragmltnplrdrfgivqrlefynvedlativsrsagilgleiep
    qgaaeiakrargtprianrllrrvrdfaevrgqgditrviadkalnlldvdergfdhldr
    rllltmidkfdggpvgidnlaaalseerhtiedvlepyliqqgyimrtprgrvvtrhayl
    hfglnipkrlg