PDB entry 6bl6

View 6bl6 on RCSB PDB site
Description: Crystallization of lipid A transporter MsbA from Salmonella typhimurium: a novel perspective on its transport
Class: membrane protein
Keywords: MsbA, Lipid A co-crystallization, ABC transporters, Staphylococcus typhimurium, MEMBRANE PROTEIN
Deposited on 2017-11-09, released 2019-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipid A export ATP-binding/permease protein msbA
    Species: Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 [TaxId:99287]
    Gene: msbA, STM0984
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63359 (0-End)
      • engineered mutation (51)
    Domains in SCOPe 2.07: d6bl6a1, d6bl6a2
  • Chain 'B':
    Compound: Lipid A export ATP-binding/permease protein msbA
    Species: Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 [TaxId:99287]
    Gene: msbA, STM0984
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63359 (0-End)
      • engineered mutation (51)
    Domains in SCOPe 2.07: d6bl6b1, d6bl6b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bl6A (A:)
    lstwqtfrrlwptiapfkaglivagialilnaasdtfmlsllkpllddgfgatdrsvllw
    mplvviglmilrgitsyissyciswvsgkvvmtmrrrlfghmmgmpvaffdkqstgtlls
    ritydseqvassssgalitvvregasiiglfimmfyyswqlsiilvvlapivsiairvvs
    krfrsisknmqntmgqvttsaeqmlkghkevlifggqevetkrfdkvsnkmrlqgmkmvs
    assisdpiiqliaslalafvlyaasfpsvmdsltagtitvvfssmialmrplksltnvna
    qfqrgmaacqtlfaildseqekdegkrvidratgdlefrnvtftypgrevpalrninlki
    pagktvalvgrsgsgkstiaslitrfydideghilmdghdlreytlaslrnqvalvsqnv
    hlfndtvanniayarteeysreqieeaarmayamdfinkmdngldtiigengvllsggqr
    qriaiarallrdspilildeatsaldteseraiqaaldelqknrtslviahrlstieqad
    eivvvedgiivergthsellaqhgvyaqlhkmqfgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bl6A (A:)
    lstwqtfrrlwptiapfkaglivagialilnaasdtfmlsllkpllddgfgatdrsvllw
    mplvviglmilrgitsyissyciswvsgkvvmtmrrrlfghmmgmpvaffdkqstgtlls
    ritydseqvassssgalitvvregasiiglfimmfyyswqlsiilvvlapivsiairvvs
    krfrsisknmqntmgqvttsaeqmlkghkevlifggqevetkrfdkvsnkmrlqgmkmvs
    assisdpiiqliaslalafvlyaasfpsvmdsltagtitvvfssmialmrplksltnvna
    qfqrgmaacqtlfaildseqekdegkrvidratgdlefrnvtftypgrevpalrninlki
    pagktvalvgrsgsgkstiaslitrfydideghilmdghdlreytlaslrnqvalvsqnv
    hlfndtvanniayarteeysreqieeaarmayamdfinkmdngldtiigengvllsggqr
    qriaiarallrdspilildeatsaldteseraiqaaldelqknrtslviahrlstieqad
    eivvvedgiivergthsellaqhgvyaqlhkmqfg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bl6B (B:)
    lstwqtfrrlwptiapfkaglivagialilnaasdtfmlsllkpllddgfgatdrsvllw
    mplvviglmilrgitsyissyciswvsgkvvmtmrrrlfghmmgmpvaffdkqstgtlls
    ritydseqvassssgalitvvregasiiglfimmfyyswqlsiilvvlapivsiairvvs
    krfrsisknmqntmgqvttsaeqmlkghkevlifggqevetkrfdkvsnkmrlqgmkmvs
    assisdpiiqliaslalafvlyaasfpsvmdsltagtitvvfssmialmrplksltnvna
    qfqrgmaacqtlfaildseqekdegkrvidratgdlefrnvtftypgrevpalrninlki
    pagktvalvgrsgsgkstiaslitrfydideghilmdghdlreytlaslrnqvalvsqnv
    hlfndtvanniayarteeysreqieeaarmayamdfinkmdngldtiigengvllsggqr
    qriaiarallrdspilildeatsaldteseraiqaaldelqknrtslviahrlstieqad
    eivvvedgiivergthsellaqhgvyaqlhkmqfgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bl6B (B:)
    lstwqtfrrlwptiapfkaglivagialilnaasdtfmlsllkpllddgfgatdrsvllw
    mplvviglmilrgitsyissyciswvsgkvvmtmrrrlfghmmgmpvaffdkqstgtlls
    ritydseqvassssgalitvvregasiiglfimmfyyswqlsiilvvlapivsiairvvs
    krfrsisknmqntmgqvttsaeqmlkghkevlifggqevetkrfdkvsnkmrlqgmkmvs
    assisdpiiqliaslalafvlyaasfpsvmdsltagtitvvfssmialmrplksltnvna
    qfqrgmaacqtlfaildseqekdegkrvidratgdlefrnvtftypgrevpalrninlki
    pagktvalvgrsgsgkstiaslitrfydideghilmdghdlreytlaslrnqvalvsqnv
    hlfndtvanniayarteeysreqieeaarmayamdfinkmdngldtiigengvllsggqr
    qriaiarallrdspilildeatsaldteseraiqaaldelqknrtslviahrlstieqad
    eivvvedgiivergthsellaqhgvyaqlhkmqfg