PDB entry 6bk7

View 6bk7 on RCSB PDB site
Description: 1.83 Angstrom Resolution Crystal Structure of N-terminal Fragment (residues 1-404) of Elongation Factor G from Enterococcus faecalis
Class: ribosomal protein
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, Elongation factor G, RIBOSOMAL PROTEIN
Deposited on 2017-11-07, released 2017-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor G
    Species: Enterococcus faecalis (strain ATCC 700802 / V583) [TaxId:226185]
    Gene: fusA, EF_0200
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bk7a1, d6bk7a2
  • Chain 'B':
    Compound: Elongation factor G
    Species: Enterococcus faecalis (strain ATCC 700802 / V583) [TaxId:226185]
    Gene: fusA, EF_0200
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bk7b1, d6bk7b2
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bk7A (A:)
    snamarefslektrnigimahvdagktttterilyytgkihkigethegasqmdwmeqeq
    ergititsaattaqwkgyrvniidtpghvdftievqrslrvldgavtvldsqsgvepqte
    tvwrqateykvprivfcnkmdkigadffysveslhdrlqanahpiqipigaeedftgiid
    likmkaeiytndlgtdiqetdipedylekaqewreklveavaetdedlmmkylegeeite
    eelvagirqatinveffpvlagsafknkgvqlmldavldylpspldidaikgidtktdee
    ttrpaddeapfaslafkvmtdpfvgrltffrvysgvlesgsyvlnaskgkkerigrilqm
    hantrqeidkvysgdiaaavglkdtttgdtlcaldapvilesiefpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bk7A (A:)
    marefslektrnigimahvdagktttterilyytgkititsaattaqwkgyrvniidtpg
    hvdftievqrslrvldgavtvldsqsgvepqtetvwrqateykvprivfcnkmdkigadf
    fysveslhdrlqanahpiqipigaeedftgiidlikmkaeiytndlgtdiqetdipedyl
    ekaqewreklveavaetdedlmmkylegeeiteeelvagirqatinveffpvlagsafkn
    kgvqlmldavldylpspldidaikgidtktdeettrpaddeapfaslafkvmtdpfvgrl
    tffrvysgvlesgsyvlnaskgkkerigrilqmhantrqeidkvysgdiaaavglkdttt
    gdtlcaldapvilesiefpd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bk7B (B:)
    snamarefslektrnigimahvdagktttterilyytgkihkigethegasqmdwmeqeq
    ergititsaattaqwkgyrvniidtpghvdftievqrslrvldgavtvldsqsgvepqte
    tvwrqateykvprivfcnkmdkigadffysveslhdrlqanahpiqipigaeedftgiid
    likmkaeiytndlgtdiqetdipedylekaqewreklveavaetdedlmmkylegeeite
    eelvagirqatinveffpvlagsafknkgvqlmldavldylpspldidaikgidtktdee
    ttrpaddeapfaslafkvmtdpfvgrltffrvysgvlesgsyvlnaskgkkerigrilqm
    hantrqeidkvysgdiaaavglkdtttgdtlcaldapvilesiefpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bk7B (B:)
    marefslektrnigimahvdagktttterilyytgkititsaattaqwkgyrvniidtpg
    hvdftievqrslrvldgavtvldsqsgvepqtetvwrqateykvprivfcnkmdkigadf
    fysveslhdrlqanahpiqipigaeedftgiidlikmkaeiytndlgtdiqetdipedyl
    ekaqewreklveavaetdedlmmkylegeeiteeelvagirqatinveffpvlagsafkn
    kgvqlmldavldylpspldidaikgidtktdeettrpaddeapfaslafkvmtdpfvgrl
    tffrvysgvlesgsyvlnaskgkkerigrilqmhantrqeidkvysgdiaaavglkdttt
    gdtlcaldapvilesiefpd