PDB entry 6bjp

View 6bjp on RCSB PDB site
Description: Apo form of the E124S mutant of betaine aldehyde dehydrogenase from Pseudomonas aeruginosa
Class: oxidoreductase
Keywords: central cavity, cation binding site, aldehyde dehydrogenase, oxidoreductase
Deposited on 2017-11-06, released 2018-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD/NADP-dependent betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: betB, PA5373
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HTJ1 (Start-489)
      • engineered mutation (123)
    Domains in SCOPe 2.07: d6bjpa_
  • Chain 'B':
    Compound: NAD/NADP-dependent betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: betB, PA5373
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HTJ1 (Start-489)
      • engineered mutation (123)
    Domains in SCOPe 2.07: d6bjpb_
  • Chain 'C':
    Compound: NAD/NADP-dependent betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: betB, PA5373
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HTJ1 (Start-489)
      • engineered mutation (123)
    Domains in SCOPe 2.07: d6bjpc_
  • Chain 'D':
    Compound: NAD/NADP-dependent betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: betB, PA5373
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HTJ1 (Start-489)
      • engineered mutation (123)
    Domains in SCOPe 2.07: d6bjpd_
  • Heterogens: K, GOL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bjpA (A:)
    marfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvw
    aamtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglv
    paisgeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsev
    tpltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmas
    asssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqa
    rfeakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtd
    gafgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvv
    tqdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvq
    velgdyasvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bjpA (A:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aisgeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekggkspliifpdadldra
    adiavmanffssgqvctngtrvfihrsqqarfeakvlervqrirlgdpqdentnfgplvs
    fphmesvlgyiesgkaqkarllcggervtdgafgkgayvaptvftdcrddmtivreeifg
    pvmsilvyddedeairrandteyglaagvvtqdlarahraihrleagicwintwgespae
    mpvggykqsgvgrenglttlahytriksvqvelgdyasvf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bjpB (B:)
    marfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvw
    aamtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglv
    paisgeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsev
    tpltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmas
    asssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqa
    rfeakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtd
    gafgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvv
    tqdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvq
    velgdyasvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bjpB (B:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aisgeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftglggkspliifpd
    adldraadiavmanffssgqvctngtrvfihrsqqarfeakvlervqrirlgdpqdentn
    fgplvsfphmesvlgyiesgkaqkarllcggervtdgafgkgayvaptvftdcrddmtiv
    reeifgpvmsilvyddedeairrandteyglaagvvtqdlarahraihrleagicwintw
    gespaempvggykqsgvgrenglttlahytriksvqvelgdyasvf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6bjpC (C:)
    marfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvw
    aamtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglv
    paisgeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsev
    tpltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmas
    asssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqa
    rfeakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtd
    gafgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvv
    tqdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvq
    velgdyasvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bjpC (C:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aisgeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftgkspliifpdadl
    draadiavmanffssgqvctngtrvfihrsqqarfeakvlervqrirlgdpqdentnfgp
    lvsfphmesvlgyiesgkaqkarllcggervtdgafgkgayvaptvftdcrddmtivree
    ifgpvmsilvyddedeairrandteyglaagvvtqdlarahraihrleagicwintwges
    paempvggykqsgvgrenglttlahytriksvqvelgdyasvf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6bjpD (D:)
    marfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvw
    aamtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglv
    paisgeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsev
    tpltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmas
    asssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqa
    rfeakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtd
    gafgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvv
    tqdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvq
    velgdyasvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bjpD (D:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aisgeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisgkspliifpdadldr
    aadiavmanffssgqvctngtrvfihrsqqarfeakvlervqrirlgdpqdentnfgplv
    sfphmesvlgyiesgkaqkarllcggervtdgafgkgayvaptvftdcrddmtivreeif
    gpvmsilvyddedeairrandteyglaagvvtqdlarahraihrleagicwintwgespa
    empvggykqsgvgrenglttlahytriksvqvelgdyasvf