PDB entry 6bj0

View 6bj0 on RCSB PDB site
Description: Crystal structure of wild-type human phosphoglucomutase 1 in complex with Glucose-6-Phosphate
Class: isomerase
Keywords: phosphoglucomutase, G6P, ISOMERASE
Deposited on 2017-11-03, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoglucomutase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PGM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36871 (23-584)
      • expression tag (21-22)
    Domains in SCOPe 2.07: d6bj0a1, d6bj0a2, d6bj0a3, d6bj0a4, d6bj0a5
  • Chain 'B':
    Compound: Phosphoglucomutase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PGM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36871 (23-584)
      • expression tag (21-22)
    Domains in SCOPe 2.07: d6bj0b1, d6bj0b2, d6bj0b3, d6bj0b4, d6bj0b5
  • Heterogens: G6P, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bj0A (A:)
    mhhhhhhssgvdlgtenlyfqsnmvkivtvktqayqdqkpgtsglrkrvkvfqssanyae
    nfiqsiistvepaqrqeatlvvggdgrfymkeaiqliariaaangigrlvigqngilstp
    avsciirkikaiggiiltashnpggpngdfgikfnisnggpapeaitdkifqisktieey
    avcpdlkvdlgvlgkqqfdlenkfkpftveivdsveayatmlrsifdfsalkellsgpnr
    lkiridamhgvvgpyvkkilceelgapansavncvpledfgghhpdpnltyaadlvetmk
    sgehdfgaafdgdgdrnmilgkhgffvnpsdsvaviaanifsipyfqqtgvrgfarsmpt
    sgaldrvasatkialyetptgwkffgnlmdasklslcgeesfgtgsdhirekdglwavla
    wlsilatrkqsvedilkdhwqkygrnfftrydyeeveaegankmmkdlealmfdrsfvgk
    qfsandkvytvekadnfeysdpvdgsisrnqglrliftdgsrivfrlsgtgsagatirly
    idsyekdvakinqdpqvmlaplisialkvsqlqertgrtaptvit
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bj0A (A:)
    snmvkivtvktqayqdqkpgtsglrkrvkvfqssanyaenfiqsiistvepaqrqeatlv
    vggdgrfymkeaiqliariaaangigrlvigqngilstpavsciirkikaiggiiltash
    npggpngdfgikfnisnggpapeaitdkifqisktieeyavcpdlkvdlgvlgkqqfdle
    nkfkpftveivdsveayatmlrsifdfsalkellsgpnrlkiridamhgvvgpyvkkilc
    eelgapansavncvpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilg
    khgffvnpsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvasatkialyetptg
    wkffgnlmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwq
    kygrnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysd
    pvdgsisrnqglrliftdgsrivfrlsgtgsagatirlyidsyekdvakinqdpqvmlap
    lisialkvsqlqertgrtaptvit
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bj0B (B:)
    mhhhhhhssgvdlgtenlyfqsnmvkivtvktqayqdqkpgtsglrkrvkvfqssanyae
    nfiqsiistvepaqrqeatlvvggdgrfymkeaiqliariaaangigrlvigqngilstp
    avsciirkikaiggiiltashnpggpngdfgikfnisnggpapeaitdkifqisktieey
    avcpdlkvdlgvlgkqqfdlenkfkpftveivdsveayatmlrsifdfsalkellsgpnr
    lkiridamhgvvgpyvkkilceelgapansavncvpledfgghhpdpnltyaadlvetmk
    sgehdfgaafdgdgdrnmilgkhgffvnpsdsvaviaanifsipyfqqtgvrgfarsmpt
    sgaldrvasatkialyetptgwkffgnlmdasklslcgeesfgtgsdhirekdglwavla
    wlsilatrkqsvedilkdhwqkygrnfftrydyeeveaegankmmkdlealmfdrsfvgk
    qfsandkvytvekadnfeysdpvdgsisrnqglrliftdgsrivfrlsgtgsagatirly
    idsyekdvakinqdpqvmlaplisialkvsqlqertgrtaptvit
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bj0B (B:)
    snmvkivtvktqayqdqkpgtsglrkrvkvfqssanyaenfiqsiistvepaqrqeatlv
    vggdgrfymkeaiqliariaaangigrlvigqngilstpavsciirkikaiggiiltash
    npggpngdfgikfnisnggpapeaitdkifqisktieeyavcpdlkvdlgvlgkqqfdle
    nkfkpftveivdsveayatmlrsifdfsalkellsgpnrlkiridamhgvvgpyvkkilc
    eelgapansavncvpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilg
    khgffvnpsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvasatkialyetptg
    wkffgnlmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwq
    kygrnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysd
    pvdgsisrnqglrliftdgsrivfrlsgtgsagatirlyidsyekdvakinqdpqvmlap
    lisialkvsqlqertgrtaptvit