PDB entry 6bi8

View 6bi8 on RCSB PDB site
Description: X-ray structure of MERS coronavirus papain-like protease in complex with human ISG15
Class: hydrolase/substrate
Keywords: Complex, signaling protein, deISGylase, HYDROLASE, HYDROLASE-SUBSTRATE complex
Deposited on 2017-11-01, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ORF1a
    Species: Human betacoronavirus 2c EMC/2012 [TaxId:1235996]
    Gene: orf1ab
    Database cross-references and differences (RAF-indexed):
    • Uniprot K4LC41 (1-258)
      • expression tag (0)
  • Chain 'B':
    Compound: ORF1a
    Species: Human betacoronavirus 2c EMC/2012 [TaxId:1235996]
    Gene: orf1ab
    Database cross-references and differences (RAF-indexed):
    • Uniprot K4LC41 (1-258)
      • expression tag (0)
  • Chain 'C':
    Compound: Ubiquitin-like protein ISG15
    Species: Homo sapiens [TaxId:9606]
    Gene: ISG15, G1P2, UCRP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05161 (Start-155)
      • engineered mutation (77)
    Domains in SCOPe 2.07: d6bi8c1, d6bi8c2
  • Chain 'D':
    Compound: Ubiquitin-like protein ISG15
    Species: Homo sapiens [TaxId:9606]
    Gene: ISG15, G1P2, UCRP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05161 (Start-155)
      • engineered mutation (77)
    Domains in SCOPe 2.07: d6bi8d1, d6bi8d2
  • Heterogens: PGE, ZN, GOL, AYE, CIT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6bi8C (C:)
    mgwdltvkmlagnefqvslsssmsvselkaqitqkigvhafqqrlavhpsgvalqdrvpl
    asqglgpgstvllvvdksdeplsilvrnnkgrsstyevrltqtvahlkqqvsglegvqdd
    lfwltfegkpledqlplgeyglkplstvfmnlrlrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bi8C (C:)
    dltvkmlagnefqvslsssmsvselkaqitqkigvhafqqrlavhpsgvalqdrvplasq
    glgpgstvllvvdksdeplsilvrnnkgrsstyevrltqtvahlkqqvsglegvqddlfw
    ltfegkpledqlplgeyglkplstvfmnlrlrg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6bi8D (D:)
    mgwdltvkmlagnefqvslsssmsvselkaqitqkigvhafqqrlavhpsgvalqdrvpl
    asqglgpgstvllvvdksdeplsilvrnnkgrsstyevrltqtvahlkqqvsglegvqdd
    lfwltfegkpledqlplgeyglkplstvfmnlrlrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bi8D (D:)
    dltvkmlagnefqvslsssmsvselkaqitqkigvhafqqrlavhpsgvalqdrvplasq
    glgpgstvllvvdksdeplsilvrnnkgrsstyevrltqtvahlkqqvsglegvqddlfw
    ltfegkpledqlplgeyglkplstvfmnlrlrg