PDB entry 6bhw

View 6bhw on RCSB PDB site
Description: B. subtilis SsbA
Class: DNA binding protein
Keywords: Single-stranded DNA binding protein, DNA Replication, DNA Repair, DNA BINDING PROTEIN
Deposited on 2017-10-31, released 2018-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Single-stranded DNA-binding protein A
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: ssbA, BSU40900
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37455 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d6bhwa1, d6bhwa2
  • Chain 'B':
    Compound: Single-stranded DNA-binding protein A
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: ssbA, BSU40900
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37455 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d6bhwb1, d6bhwb2
  • Chain 'C':
    Compound: Single-stranded DNA-binding protein A
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: ssbA, BSU40900
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37455 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d6bhwc1, d6bhwc2
  • Chain 'D':
    Compound: Single-stranded DNA-binding protein A
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: ssbA, BSU40900
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37455 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d6bhwd1, d6bhwd2
  • Chain 'E':
    Compound: Single-stranded DNA-binding protein A
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: ssbA, BSU40900
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37455 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d6bhwe1, d6bhwe2
  • Chain 'F':
    Compound: Single-stranded DNA-binding protein A
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: ssbA, BSU40900
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37455 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d6bhwf1, d6bhwf2
  • Chain 'G':
    Compound: Single-stranded DNA-binding protein A
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: ssbA, BSU40900
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bhwg_
  • Chain 'H':
    Compound: Single-stranded DNA-binding protein A
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: ssbA, BSU40900
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37455 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d6bhwh1, d6bhwh2
  • Heterogens: PEG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bhwA (A:)
    gshmlnrvvlvgrltkdpelrytpngaavatftlavnrtftnqsgereadfincvtwrrq
    aenvanflkkgslagvdgrlqtrnyenqqgqrvfvtevqaesvqflepkngggsgsggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bhwA (A:)
    gshmlnrvvlvgrltkdpelrytpngaavatftlavnrtftnqereadfincvtwrrqae
    nvanflkkgslagvdgrlqtrnyenfvtevqaesvqflep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bhwB (B:)
    gshmlnrvvlvgrltkdpelrytpngaavatftlavnrtftnqsgereadfincvtwrrq
    aenvanflkkgslagvdgrlqtrnyenqqgqrvfvtevqaesvqflepkngggsgsggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bhwB (B:)
    hmlnrvvlvgrltkdpelrytpngaavatftlavnrtgereadfincvtwrrqaenvanf
    lkkgslagvdgrlqtrnyenqqgqrvfvtevqaesvqfle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6bhwC (C:)
    gshmlnrvvlvgrltkdpelrytpngaavatftlavnrtftnqsgereadfincvtwrrq
    aenvanflkkgslagvdgrlqtrnyenqqgqrvfvtevqaesvqflepkngggsgsggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bhwC (C:)
    gshmlnrvvlvgrltkdpelrytpngaavatftlavnrtereadfincvtwrrqaenvan
    flkkgslagvdgrlqtrnyenqqgqrvfvtevqaesvqflep
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6bhwD (D:)
    gshmlnrvvlvgrltkdpelrytpngaavatftlavnrtftnqsgereadfincvtwrrq
    aenvanflkkgslagvdgrlqtrnyenqqgqrvfvtevqaesvqflepkngggsgsggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bhwD (D:)
    hmlnrvvlvgrltkdpelrytpngaavatftlavnrteadfincvtwrrqaenvanflkk
    gslagvdgrlqtrnyenqqrvfvtevqaesvqflep
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6bhwE (E:)
    gshmlnrvvlvgrltkdpelrytpngaavatftlavnrtftnqsgereadfincvtwrrq
    aenvanflkkgslagvdgrlqtrnyenqqgqrvfvtevqaesvqflepkngggsgsggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bhwE (E:)
    hmlnrvvlvgrltkdpelrytpngaavatftlavnrtfereadfincvtwrrqaenvanf
    lkkgslagvdgrlqtrnyenqqgqrvfvtevqaesvqfl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6bhwF (F:)
    gshmlnrvvlvgrltkdpelrytpngaavatftlavnrtftnqsgereadfincvtwrrq
    aenvanflkkgslagvdgrlqtrnyenqqgqrvfvtevqaesvqflepkngggsgsggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bhwF (F:)
    hmlnrvvlvgrltkdpelrytpngaavatftlavnrtfeadfincvtwrrqaenvanflk
    kgslagvdgrlqtrnyenqqgqrvfvtevqaesvqf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6bhwG (G:)
    gshmlnrvvlvgrltkdpelrytpngaavatftlavnrtftnqsgereadfincvtwrrq
    aenvanflkkgslagvdgrlqtrnyenqqgqrvfvtevqaesvqflepkngggsgsggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bhwG (G:)
    mlnrvvlvgrltkdpelrytpngaavatftlavnrtftgereadfincvtwrrqaenvan
    flkkgslagvdgrlqtrnyenqqgqrvfvtevqaesvqfle
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6bhwH (H:)
    gshmlnrvvlvgrltkdpelrytpngaavatftlavnrtftnqsgereadfincvtwrrq
    aenvanflkkgslagvdgrlqtrnyenqqgqrvfvtevqaesvqflepkngggsgsggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bhwH (H:)
    hmlnrvvlvgrltkdpelrytpngaavatftlavnrtfnqsgereadfincvtwrrqaen
    vanflkkgslagvdgrlqtrnyenqqvfvtevqaesvqfl