PDB entry 6bhn

View 6bhn on RCSB PDB site
Description: Red Light-Absorbing State of NpR6012g4, a Red/Green Cyanobacteriochrome
Class: signaling protein
Keywords: CBCR, phytochrome, bilin, cyanobacteria, SIGNALING PROTEIN
Deposited on 2017-10-31, released 2018-04-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methyl-accepting chemotaxis sensory transducer with phytochrome sensor
    Species: Nostoc punctiforme (strain ATCC 29133 / PCC 73102) [TaxId:63737]
    Gene: Npun_R6012
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6bhna_
  • Heterogens: CYC

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6bhnA (A:)
mgekavtkisnrirqssdveeifktttqevrqllrcdrvavyrfnpnwtgefvaesvaht
wvklvgpdiktvwedthlqetqggryaqgenfvvndiyqvghspchieileqfevkayvi
vpvfageqlwgllaayqnsgtrdwdesevtllarignqlglalqqteylqqvqgqsakpg

    Sequence, based on observed residues (ATOM records): (download) 
    >6bhnA (A:)
sdveeifktttqevrqllrcdrvavyrfnpnwtgefvaesvahtwvklvgpdiktvwedt
hlqetqggryaqgenfvvndiyqvghspchieileqfevkayvivpvfageqlwgllaay
qnsgtrdwdesevtllarignqlglalqqteylqqv