PDB entry 6bfz

View 6bfz on RCSB PDB site
Description: Crystal structure of enolase from E. coli with a mixture of apo form, substrate, and product form
Class: lyase
Keywords: Enolase, Escherichia coli, Apo, substrate, product, LYASE
Deposited on 2017-10-27, released 2018-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enolase
    Species: Escherichia coli [TaxId:562]
    Gene: eno, ECS88_3047
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7MLA0 (17-448)
      • expression tag (10-16)
    Domains in SCOPe 2.07: d6bfza1, d6bfza2, d6bfza3
  • Chain 'B':
    Compound: enolase
    Species: Escherichia coli [TaxId:562]
    Gene: eno, ECS88_3047
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7MLA0 (17-448)
      • expression tag (10-16)
    Domains in SCOPe 2.07: d6bfzb1, d6bfzb2, d6bfzb3
  • Chain 'C':
    Compound: enolase
    Species: Escherichia coli [TaxId:562]
    Gene: eno, ECS88_3047
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7MLA0 (17-448)
      • expression tag (10-16)
    Domains in SCOPe 2.07: d6bfzc1, d6bfzc2, d6bfzc3
  • Chain 'D':
    Compound: enolase
    Species: Escherichia coli [TaxId:562]
    Gene: eno, ECS88_3047
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7MLA0 (17-448)
      • expression tag (10-16)
    Domains in SCOPe 2.07: d6bfzd1, d6bfzd2, d6bfzd3
  • Chain 'E':
    Compound: enolase
    Species: Escherichia coli [TaxId:562]
    Gene: eno, ECS88_3047
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7MLA0 (17-448)
      • expression tag (10-16)
    Domains in SCOPe 2.07: d6bfze1, d6bfze2, d6bfze3
  • Chain 'F':
    Compound: enolase
    Species: Escherichia coli [TaxId:562]
    Gene: eno, ECS88_3047
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7MLA0 (17-End)
      • expression tag (10-16)
    Domains in SCOPe 2.07: d6bfzf1, d6bfzf2, d6bfzf3
  • Heterogens: MG, SO4, GOL, PEP, 2PG, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bfzA (A:)
    gshmasmtggqqmgrgsmskivkiigreiidsrgnptveaevhleggfvgmaaapsgast
    gsrealelrdgdksrflgkgvtkavaavngpiaqaligkdakdqagidkimidldgtenk
    skfganailavslanakaaaaakgmplyehiaelngtpgkysmpvpmmniinggehadnn
    vdiqefmiqpvgaktvkeairmgsevfhhlakvlkakgmntavgdeggyapnlgsnaeal
    aviaeavkaagyelgkditlamdcaasefykdgkyvlagegnkaftseefthfleeltkq
    ypivsiedgldesdwdgfayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikf
    nqigsltetlaaikmakdagytavishrsgetedatiadlavgtaagqiktgsmsrsdrv
    akynqlirieealgekapyngrkeikgqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bfzA (A:)
    qqmgrgsmskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrd
    gdksrflgkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganaila
    vslanakaaaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqp
    vgaktvkeairmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaa
    gyelgkditlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgl
    desdwdgfayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetl
    aaikmakdagytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirie
    ealgekapyngrkeikgqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bfzB (B:)
    gshmasmtggqqmgrgsmskivkiigreiidsrgnptveaevhleggfvgmaaapsgast
    gsrealelrdgdksrflgkgvtkavaavngpiaqaligkdakdqagidkimidldgtenk
    skfganailavslanakaaaaakgmplyehiaelngtpgkysmpvpmmniinggehadnn
    vdiqefmiqpvgaktvkeairmgsevfhhlakvlkakgmntavgdeggyapnlgsnaeal
    aviaeavkaagyelgkditlamdcaasefykdgkyvlagegnkaftseefthfleeltkq
    ypivsiedgldesdwdgfayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikf
    nqigsltetlaaikmakdagytavishrsgetedatiadlavgtaagqiktgsmsrsdrv
    akynqlirieealgekapyngrkeikgqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bfzB (B:)
    qqmgrgsmskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrd
    gdksrflgkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganaila
    vslanakaaaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqp
    vgaktvkeairmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaa
    gyelgkditlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgl
    desdwdgfayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetl
    aaikmakdagytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirie
    ealgekapyngrkeikgqa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6bfzC (C:)
    gshmasmtggqqmgrgsmskivkiigreiidsrgnptveaevhleggfvgmaaapsgast
    gsrealelrdgdksrflgkgvtkavaavngpiaqaligkdakdqagidkimidldgtenk
    skfganailavslanakaaaaakgmplyehiaelngtpgkysmpvpmmniinggehadnn
    vdiqefmiqpvgaktvkeairmgsevfhhlakvlkakgmntavgdeggyapnlgsnaeal
    aviaeavkaagyelgkditlamdcaasefykdgkyvlagegnkaftseefthfleeltkq
    ypivsiedgldesdwdgfayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikf
    nqigsltetlaaikmakdagytavishrsgetedatiadlavgtaagqiktgsmsrsdrv
    akynqlirieealgekapyngrkeikgqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bfzC (C:)
    qqmgrgsmskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrd
    gdksrflgkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganaila
    vslanakaaaaakgmplyehiaelngtpgkysmpvpmmniinggdnvdiqefmiqpvgak
    tvkeairmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaagyel
    gkditlamdcaasefykdgkyvlaftseefthfleeltkqypivsiedgldesdwdgfay
    qtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetlaaikmakdag
    ytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirieealgekapyn
    grkeikgqa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6bfzD (D:)
    gshmasmtggqqmgrgsmskivkiigreiidsrgnptveaevhleggfvgmaaapsgast
    gsrealelrdgdksrflgkgvtkavaavngpiaqaligkdakdqagidkimidldgtenk
    skfganailavslanakaaaaakgmplyehiaelngtpgkysmpvpmmniinggehadnn
    vdiqefmiqpvgaktvkeairmgsevfhhlakvlkakgmntavgdeggyapnlgsnaeal
    aviaeavkaagyelgkditlamdcaasefykdgkyvlagegnkaftseefthfleeltkq
    ypivsiedgldesdwdgfayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikf
    nqigsltetlaaikmakdagytavishrsgetedatiadlavgtaagqiktgsmsrsdrv
    akynqlirieealgekapyngrkeikgqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bfzD (D:)
    qqmgrgsmskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrd
    gdksrflgkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganaila
    vslanakaaaaakgmplyehiaelngtpgkysmpvpmmniinggehdnnvdiqefmiqpv
    gaktvkeairmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaag
    yelgkditlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgld
    esdwdgfayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetla
    aikmakdagytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqliriee
    algekapyngrkeikgqa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6bfzE (E:)
    gshmasmtggqqmgrgsmskivkiigreiidsrgnptveaevhleggfvgmaaapsgast
    gsrealelrdgdksrflgkgvtkavaavngpiaqaligkdakdqagidkimidldgtenk
    skfganailavslanakaaaaakgmplyehiaelngtpgkysmpvpmmniinggehadnn
    vdiqefmiqpvgaktvkeairmgsevfhhlakvlkakgmntavgdeggyapnlgsnaeal
    aviaeavkaagyelgkditlamdcaasefykdgkyvlagegnkaftseefthfleeltkq
    ypivsiedgldesdwdgfayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikf
    nqigsltetlaaikmakdagytavishrsgetedatiadlavgtaagqiktgsmsrsdrv
    akynqlirieealgekapyngrkeikgqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bfzE (E:)
    qqmgrgsmskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrd
    gdksrflgkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganaila
    vslanakaaaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqp
    vgaktvkeairmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaa
    gyelgkditlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgl
    desdwdgfayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetl
    aaikmakdagytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirie
    ealgekapyngrkeikgqa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6bfzF (F:)
    gshmasmtggqqmgrgsmskivkiigreiidsrgnptveaevhleggfvgmaaapsgast
    gsrealelrdgdksrflgkgvtkavaavngpiaqaligkdakdqagidkimidldgtenk
    skfganailavslanakaaaaakgmplyehiaelngtpgkysmpvpmmniinggehadnn
    vdiqefmiqpvgaktvkeairmgsevfhhlakvlkakgmntavgdeggyapnlgsnaeal
    aviaeavkaagyelgkditlamdcaasefykdgkyvlagegnkaftseefthfleeltkq
    ypivsiedgldesdwdgfayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikf
    nqigsltetlaaikmakdagytavishrsgetedatiadlavgtaagqiktgsmsrsdrv
    akynqlirieealgekapyngrkeikgqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bfzF (F:)
    qqmgrgsmskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrd
    gdksrflgkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganaila
    vslanakaaaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqp
    vgaktvkeairmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaa
    gyelgkditlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgl
    desdwdgfayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetl
    aaikmakdagytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirie
    ealgekapyngrkeikgq