PDB entry 6bdk

View 6bdk on RCSB PDB site
Description: Crystal structure of human CYP3A4 bound to an inhibitor
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: cytochrome P450, monooxygenase, inhibitor, OXIDOREDUCTASE, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2017-10-23, released 2017-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 2.67 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 3a4
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP3A4, CYP3A3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bdka_
  • Heterogens: HEM, DJ1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bdkA (A:)
    maylygthshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqp
    vlaitdpdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsg
    klkemvpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpq
    dpfventkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesr
    ledtqkhrvdflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimye
    lathpdvqqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkd
    veingmfipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgpr
    ncigmrfalmnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrdgtv
    sgahhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bdkA (A:)
    thshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitd
    pdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemv
    piiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfven
    tkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledvdf
    lqlmidsqnshkalsdlelvaqsiififagyettssvlsfimyelathpdvqqklqeeid
    avlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmfipkgvvvmi
    psyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrfalmnmklal
    irvlqnfsfkpcketqiplklslggllqpekpvvlkvesrd