PDB entry 6bdf

View 6bdf on RCSB PDB site
Description: 2.8 A resolution reconstruction of the Thermoplasma acidophilum 20S proteasome using cryo-electron microscopy
Class: hydrolase
Keywords: proteasome, HYDROLASE
Deposited on 2017-10-23, released 2017-12-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-17, with a file datestamp of 2018-01-12.
Experiment type: EM
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmA, Ta1288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bdf0_
  • Chain '1':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB, Ta0612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bdf1_
  • Chain 'A':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmA, Ta1288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bdfa_
  • Chain 'B':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB, Ta0612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bdfb_
  • Chain 'C':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmA, Ta1288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bdfc_
  • Chain 'D':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB, Ta0612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bdfd_
  • Chain 'E':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmA, Ta1288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bdfe_
  • Chain 'F':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB, Ta0612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bdff_
  • Chain 'G':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmA, Ta1288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bdfg_
  • Chain 'H':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB, Ta0612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bdfh_
  • Chain 'I':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmA, Ta1288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bdfi_
  • Chain 'J':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB, Ta0612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bdfj_
  • Chain 'K':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmA, Ta1288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bdfk_
  • Chain 'L':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB, Ta0612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bdfl_
  • Chain 'M':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmA, Ta1288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bdfm_
  • Chain 'N':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB, Ta0612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bdfn_
  • Chain 'O':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmA, Ta1288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bdfo_
  • Chain 'P':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB, Ta0612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bdfp_
  • Chain 'Q':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmA, Ta1288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bdfq_
  • Chain 'R':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB, Ta0612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bdfr_
  • Chain 'S':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmA, Ta1288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bdfs_
  • Chain 'T':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB, Ta0612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bdft_
  • Chain 'U':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmA, Ta1288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bdfu_
  • Chain 'V':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB, Ta0612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bdfv_
  • Chain 'W':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmA, Ta1288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bdfw_
  • Chain 'X':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB, Ta0612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bdfx_
  • Chain 'Y':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmA, Ta1288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bdfy_
  • Chain 'Z':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB, Ta0612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bdfz_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain '0':
    Sequence, based on SEQRES records: (download)
    >6bdf0 (0:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bdf0 (0:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >6bdf1 (1:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglil
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bdf1 (1:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklgl
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bdfA (A:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bdfA (A:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bdfB (B:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglil
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bdfB (B:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklgl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6bdfC (C:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bdfC (C:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6bdfD (D:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglil
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bdfD (D:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklgl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6bdfE (E:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bdfE (E:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6bdfF (F:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglil
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bdfF (F:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklgl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6bdfG (G:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bdfG (G:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6bdfH (H:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglil
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bdfH (H:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklgl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6bdfI (I:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bdfI (I:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6bdfJ (J:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglil
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bdfJ (J:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklgl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6bdfK (K:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bdfK (K:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6bdfL (L:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglil
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bdfL (L:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklgl
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6bdfM (M:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bdfM (M:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >6bdfN (N:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglil
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bdfN (N:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklgl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >6bdfO (O:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bdfO (O:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >6bdfP (P:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglil
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bdfP (P:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklgl
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >6bdfQ (Q:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bdfQ (Q:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >6bdfR (R:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglil
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bdfR (R:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklgl
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >6bdfS (S:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bdfS (S:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >6bdfT (T:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglil
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bdfT (T:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklgl
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >6bdfU (U:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bdfU (U:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >6bdfV (V:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglil
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bdfV (V:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklgl
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >6bdfW (W:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bdfW (W:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >6bdfX (X:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglil
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bdfX (X:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklgl
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >6bdfY (Y:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bdfY (Y:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >6bdfZ (Z:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglil
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bdfZ (Z:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklgl