PDB entry 6bcz

View 6bcz on RCSB PDB site
Description: Crystal structure of human CYP3A4 bound to an inhibitor
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: monooxygenase, inhibitor, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2017-10-20, released 2017-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 3a4
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP3A4, CYP3A3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bcza_
  • Heterogens: HEM, D7Y, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bczA (A:)
    maylygthshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqp
    vlaitdpdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsg
    klkemvpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpq
    dpfventkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesr
    ledtqkhrvdflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimye
    lathpdvqqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkd
    veingmfipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgpr
    ncigmrfalmnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrdgtv
    sgahhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bczA (A:)
    thshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitd
    pdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemv
    piiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfven
    tkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledvdf
    lqlmidsqnsshkalsdlelvaqsiififagyettssvlsfimyelathpdvqqklqeei
    davlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmfipkgvvvm
    ipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrfalmnmkla
    lirvlqnfsfkpcketqiplklslggllqpekpvvlkvesr