PDB entry 6bcs

View 6bcs on RCSB PDB site
Description: LilrB2 D1D2 domains complexed with benzamidine
Class: immune system
Keywords: receptor, IG LIKE DOMAINS, IMMUNE SYSTEM
Deposited on 2017-10-20, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Leukocyte immunoglobulin-like receptor subfamily B member 2
    Species: Homo sapiens [TaxId:9606]
    Gene: LILRB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bcsa1, d6bcsa2
  • Heterogens: BEN, CL, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bcsA (A:)
    mgtipkptlwaepdsvitqgspvtlscqgsleaqeyrlyrekksaswitrirpelvkngq
    fhipsitwehtgrygcqyysrarwselsdplvlvmtgaypkptlsaqpspvvtsggrvtl
    qcesqvafggfilckegedehpqclnsqphargssraifsvgpvspnrrwshrcygydln
    spyvwsspsdllellvpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bcsA (A:)
    tipkptlwaepdsvitqgspvtlscqgsleaqeyrlyrekksaswitrirpelvkngqfh
    ipsitwehtgrygcqyysrarwselsdplvlvmtgaypkptlsaqpspvvtsggrvtlqc
    esqvafggfilckegedehpqclnsqphargssraifsvgpvspnrrwshrcygydlnsp
    yvwsspsdllellvpg