PDB entry 6bca

View 6bca on RCSB PDB site
Description: A Complex between PH Domain of LbcRhoGEF (AKAP-Lbc) and Activated RhoA Bound to a GTP Analog
Class: signaling protein
Keywords: Rho GTPase Guanine Nucleotide Exchange Factors RhoGEF Pleckstrin Homology PH domain, SIGNALING PROTEIN
Deposited on 2017-10-20, released 2017-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: A-kinase anchor protein 13
    Species: Homo sapiens [TaxId:9606]
    Gene: AKAP13, BRX, HT31, LBC
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: A-kinase anchor protein 13
    Species: Homo sapiens [TaxId:9606]
    Gene: AKAP13, BRX, HT31, LBC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12802 (Start-144)
      • expression tag (145-146)
  • Chain 'C':
    Compound: transforming protein rhoa
    Species: Homo sapiens [TaxId:9606]
    Gene: RHOA, ARH12, ARHA, RHO12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bcac_
  • Chain 'F':
    Compound: transforming protein rhoa
    Species: Homo sapiens [TaxId:9606]
    Gene: RHOA, ARH12, ARHA, RHO12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bcaf_
  • Heterogens: MG, GSP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6bcaC (C:)
    gildmaairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvela
    lwdtagqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvg
    nkkdlrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematr
    aalqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bcaC (C:)
    airkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtag
    qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
    ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6bcaF (F:)
    gildmaairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvela
    lwdtagqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvg
    nkkdlrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematr
    aalqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bcaF (F:)
    airkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtag
    qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
    ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqa