PDB entry 6bbd

View 6bbd on RCSB PDB site
Description: Structure of N-glycosylated porcine surfactant protein-D complexed with glycerol
Class: surfactant protein
Keywords: innate immunity, surfactant, N-linked glycan, C-type lectin, SURFACTANT PROTEIN
Deposited on 2017-10-18, released 2018-05-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pulmonary surfactant-associated protein D
    Species: Sus scrofa [TaxId:9823]
    Gene: SFTPD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6bbda1, d6bbda2
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6bbdA (A:)
talrqqvetlqgqvqrlqkafsqykkvelfpngrgvgekifktggfektfqdaqqvctqa
ggqmasprsetenealsqlvtaqnkaaflsmtdiktegnftyptgeplvyanwapgepnn
nggssgaencveifpngkwndkacgelrlvicef